Comparing RR42_RS18215 FitnessBrowser__Cup4G11:RR42_RS18215 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 95% coverage: 17:394/397 of query aligns to 51:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 14:394/397 of query aligns to 52:427/442 of P54968
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 94% coverage: 16:390/397 of query aligns to 12:372/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
33% identity, 88% coverage: 3:352/397 of query aligns to 5:357/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 84% coverage: 3:337/397 of query aligns to 8:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
25% identity, 69% coverage: 17:289/397 of query aligns to 21:274/391 of 3ramA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
26% identity, 56% coverage: 108:330/397 of query aligns to 114:331/373 of 3rzaA
Sites not aligning to the query:
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
19% identity, 82% coverage: 11:336/397 of query aligns to 2:341/377 of P44514
Sites not aligning to the query:
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
19% identity, 82% coverage: 11:336/397 of query aligns to 6:345/380 of 5vo3A
Sites not aligning to the query:
>RR42_RS18215 FitnessBrowser__Cup4G11:RR42_RS18215
MTLIPEILQAQPEIRSIRRDIHAHPELCFKEERTSDVVAQNLAAWGIEVHRGLGTTGLVG
VIRNGSSKRSIGLRADMDALPLQEANTFGHRSQHDGRMHACGHDGHTAMLLGAARYLAEH
RNFDGTINLIFQPAEEGGGGAREMIKDGLFERFPCDAVFGMHNWPGMPAGSFGTTAGPLM
ASSNEFRIVVRGKGAHAALPHNGNDPVFTGAQIVSALQGIITRNKRPIDAAVISVTQFHG
GDATNIVPDQVWIGGTVRTFTLPVLDLIERRMEEVSKAVASAFDCTVEFEFHRNYPPTVN
SATETAFAVEVASELVGAGNVDGNIEPTMGAEDFSFMLLEKPGCYLFIGNGEGVHREAGH
GLGPCMLHNPSYDFNDEILPVGSTFFVKLAEKWLAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory