SitesBLAST
Comparing RR42_RS18265 FitnessBrowser__Cup4G11:RR42_RS18265 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
79% identity, 98% coverage: 7:431/433 of query aligns to 2:427/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K70), S90 (= S95), S91 (= S96), G92 (= G97), T93 (= T98), T94 (= T99), F138 (= F143), A211 (= A216), E212 (= E217), P213 (= P218), D232 (= D237), I233 (= I238), Y234 (= Y239), G235 (= G240), L236 (= L241), S237 (= S242), D302 (= D307), I320 (≠ V326), R323 (= R329), K419 (= K423)
- binding magnesium ion: V200 (≠ T205), S202 (= S207), L204 (= L209), M226 (= M231), G227 (= G232), Q347 (≠ H353), L350 (= L356)
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
79% identity, 98% coverage: 7:431/433 of query aligns to 2:425/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (= Y138), F136 (= F143), G138 (= G145), G208 (= G215), A209 (= A216), E210 (= E217), P211 (= P218), I231 (= I238), Y232 (= Y239), G233 (= G240), L234 (= L241), S235 (= S242), P240 (= P247), D300 (= D307), R321 (= R329), K417 (= K423)
- binding magnesium ion: V198 (≠ T205), S200 (= S207), Q345 (≠ H353), L348 (= L356)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
65% identity, 98% coverage: 9:431/433 of query aligns to 6:432/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ Y138), F140 (= F143), A213 (= A216), E214 (= E217), P215 (= P218), I235 (= I238), G237 (= G240), L238 (= L241), S239 (= S242), P244 (= P247), D304 (= D307), R325 (= R329), I331 (= I335), N336 (= N340)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
65% identity, 98% coverage: 9:431/433 of query aligns to 6:432/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (≠ Y138), F140 (= F143), G212 (= G215), A213 (= A216), E214 (= E217), P215 (= P218), I235 (= I238), G237 (= G240), L238 (= L241), S239 (= S242), P244 (= P247), D304 (= D307), R325 (= R329), I331 (= I335), N336 (= N340)
- binding magnesium ion: S204 (= S207), V228 (≠ M231)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
42% identity, 97% coverage: 10:431/433 of query aligns to 9:433/435 of 4r1mA
- binding adenosine monophosphate: A215 (= A216), E216 (= E217), P217 (= P218), N236 (≠ D237), S237 (≠ I238), F238 (≠ Y239), G239 (= G240), M240 (≠ L241), T241 (≠ S242), D305 (= D307), R329 (= R329), I335 (= I335), N340 (= N340)
- binding zinc ion: C252 (= C253), H259 (≠ T261), C314 (≠ A316), C316 (≠ G318)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
45% identity, 86% coverage: 10:380/433 of query aligns to 9:380/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (= A216), E216 (= E217), P217 (= P218), S237 (≠ I238), F238 (≠ Y239), G239 (= G240), M240 (≠ L241), T241 (≠ S242), D305 (= D307), R329 (= R329), N340 (= N340)
- binding adenosine monophosphate: A215 (= A216), E216 (= E217), P217 (= P218), S237 (≠ I238), F238 (≠ Y239), G239 (= G240), M240 (≠ L241), T241 (≠ S242), D305 (= D307), R329 (= R329), N340 (= N340)
- binding coenzyme a: S136 (= S137), A164 (≠ G165), G165 (= G166), N166 (≠ Q167), S167 (≠ T168), I185 (≠ T186), Y188 (= Y189), K337 (≠ R337)
- binding zinc ion: C252 (= C253), H259 (≠ T261), C314 (≠ A316), C316 (≠ G318)
Sites not aligning to the query:
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
32% identity, 97% coverage: 10:431/433 of query aligns to 30:464/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ G215), G242 (≠ A216), E243 (= E217), P244 (= P218), G267 (≠ Y239), S268 (≠ G240), M269 (≠ L241), A270 (≠ S242), D335 (= D307), I357 (≠ V326), N371 (= N340)
- binding adenosine monophosphate: G242 (≠ A216), E243 (= E217), P244 (= P218), C266 (≠ I238), G267 (≠ Y239), S268 (≠ G240), A270 (≠ S242), E271 (= E243), D335 (= D307), N371 (= N340)
- binding coenzyme a: Y166 (≠ F143), A188 (≠ G165), G189 (vs. gap), P191 (vs. gap), S194 (≠ T168), Y210 (≠ M184), G211 (≠ V185), T212 (= T186), Y215 (= Y189), H218 (≠ A192), R368 (= R337), G369 (= G338), M401 (≠ L370), V439 (= V405), R440 (≠ T406)
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
31% identity, 97% coverage: 10:431/433 of query aligns to 30:461/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ F143), S237 (≠ G215), G263 (≠ Y239), S264 (≠ G240), M265 (≠ L241), A266 (≠ S242), F271 (≠ P247)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ F143), G164 (= G145), S237 (≠ G215), G238 (≠ A216), E239 (= E217), P240 (= P218), C262 (≠ I238), G263 (≠ Y239), S264 (≠ G240), A266 (≠ S242), F271 (≠ P247), D331 (= D307), I353 (≠ V326), R356 (= R329), K453 (= K423)
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
31% identity, 97% coverage: 10:431/433 of query aligns to 30:461/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ F143), G164 (= G145), S237 (≠ G215), G238 (≠ A216), E239 (= E217), P240 (= P218), C262 (≠ I238), G263 (≠ Y239), S264 (≠ G240), A266 (≠ S242), F271 (≠ P247), D331 (= D307), I353 (≠ V326), R356 (= R329), K453 (= K423)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ F143), G164 (= G145), S237 (≠ G215), G263 (≠ Y239), S264 (≠ G240), A266 (≠ S242), F271 (≠ P247)
6sixB Paak family amp-ligase with anp (see paper)
29% identity, 88% coverage: 20:399/433 of query aligns to 18:391/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: S88 (= S95), S89 (= S96), A213 (= A216), E214 (= E217), P215 (= P218), E236 (≠ I238), Y237 (= Y239), G238 (= G240), S239 (≠ L241), T240 (≠ S242), E241 (= E243), D300 (= D307), V320 (= V326), R323 (= R329)
- binding magnesium ion: R79 (≠ Q86), E80 (≠ D87), P121 (≠ R130), T150 (= T159)
- binding zinc ion: C249 (= C253), H255 (≠ T261), C309 (≠ S315), C311 (≠ R317)
6siyA Paak family amp-ligase with amp and substrate (see paper)
29% identity, 88% coverage: 20:399/433 of query aligns to 14:387/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (≠ Y138), P126 (≠ G139), T132 (≠ G145), L135 (≠ G148), R153 (≠ Q167), N177 (≠ T186), A209 (= A216), E232 (≠ I238), G234 (= G240), S235 (≠ L241)
- binding adenosine monophosphate: S85 (= S96), A209 (= A216), E210 (= E217), P211 (= P218), E232 (≠ I238), Y233 (= Y239), G234 (= G240), S235 (≠ L241), T236 (≠ S242), D296 (= D307), V316 (= V326)
- binding magnesium ion: R75 (≠ Q86), E76 (≠ D87), L78 (≠ V89), P117 (≠ R130), G144 (= G157), A145 (≠ L158), T146 (= T159)
6siwA Paak family amp-ligase with amp (see paper)
29% identity, 88% coverage: 20:399/433 of query aligns to 13:386/432 of 6siwA
- binding adenosine monophosphate: S84 (= S96), A208 (= A216), E209 (= E217), P210 (= P218), E231 (≠ I238), Y232 (= Y239), G233 (= G240), S234 (≠ L241), T235 (≠ S242), D295 (= D307), V315 (= V326)
- binding magnesium ion: E75 (≠ D87), L77 (≠ V89), S83 (= S95), P116 (≠ R130), G143 (= G157), T145 (= T159), E236 (= E243)
- binding zinc ion: C244 (= C253), H250 (≠ T261), C304 (≠ S315), C306 (≠ R317)
6k4cA Ancestral luciferase anclamp in complex with dlsa (see paper)
25% identity, 47% coverage: 87:290/433 of query aligns to 188:390/538 of 6k4cA
- binding 5'-o-[n-(dehydroluciferyl)-sulfamoyl] adenosine: H243 (≠ Y138), F245 (≠ Y140), T249 (= T144), G314 (≠ A216), A315 (≠ E217), P316 (= P218), G337 (≠ I238), Y338 (= Y239), G339 (= G240), L340 (= L241), T341 (≠ S242), A346 (≠ P247)
Sites not aligning to the query:
6k4dA Ancestral luciferase anclamp in complex with atp and d-luciferin (see paper)
25% identity, 47% coverage: 87:290/433 of query aligns to 188:390/539 of 6k4dA
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (4S)-2-(6-oxidanyl-1,3-benzothiazol-2-yl)-4,5-dihydro-1,3-thiazole-4-carboxylate: H243 (≠ Y138), F245 (≠ Y140), T249 (= T144), G314 (≠ A216), A315 (≠ E217), P316 (= P218), G337 (≠ I238), Y338 (= Y239), G339 (= G240), L340 (= L241), T341 (≠ S242), S345 (≠ G246), A346 (≠ P247)
- binding (4S)-2-(6-hydroxy-1,3-benzothiazol-2-yl)-4,5-dihydro-1,3-thiazole-4-carboxylic acid: F245 (≠ Y140), R335 (vs. gap), G337 (≠ I238), G339 (= G240), L340 (= L241), A346 (≠ P247)
Sites not aligning to the query:
Query Sequence
>RR42_RS18265 FitnessBrowser__Cup4G11:RR42_RS18265
MTRLTDLPLEPIETASRDALQALQLERLQWSLNHAYQNSPVYRRKFDAAGVHPNQIRTLA
DLARFPFTTKQDLRDSYPFGMFAVPQDRVARIHASSGTTGKPTVVGYTLKDIDTWATVVA
RSIRAAGARRGDKVHISYGYGLFTGGLGAHYGVEKAGLTAIPFGGGQTERQVQLIQDFKP
EVIMVTPSYMLAIADEFERQGIDPTASSLKVGIFGAEPWTPEMRLAIEKRMGISAVDIYG
LSEVMGPGVASECAQTKDGPTIWEDHFYPEVIDPLTGEVLPDGEFGELVFTSLSKEALPI
VRYRTRDLTRLLPGSARGAFRRMEKVTGRTDDMMIIRGVNVFPSQIEELILKHAELAPHY
QCVLTKDGHLDVLTVRVECAHGVDPAATHQASAQLTYDIKAFIGVTVGIEILPSGGVERS
VGKARRIVDQRPR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory