Comparing RR42_RS18310 FitnessBrowser__Cup4G11:RR42_RS18310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6y88B Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
65% identity, 99% coverage: 4:266/267 of query aligns to 5:263/265 of 6y88B
6y88G Igps (indole-3-glycerol phosphate synthase) from pseudomonas aeruginosa in complex with substrate inhibitor rcdrp (see paper)
66% identity, 89% coverage: 30:266/267 of query aligns to 18:250/253 of 6y88G
1piiA Three-dimensional structure of the bifunctional enzyme phosphoribosylanthranilate isomerase: indoleglycerolphosphate synthase from escherichia coli refined at 2.0 angstroms resolution (see paper)
40% identity, 96% coverage: 1:257/267 of query aligns to 1:244/452 of 1piiA
Sites not aligning to the query:
1jcmP Trpc stability mutant containing an engineered disulphide bridge and in complex with a cdrp-related substrate (see paper)
39% identity, 96% coverage: 1:257/267 of query aligns to 1:244/259 of 1jcmP
3t55A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with phenoxymethyl benzoic acid (pmba)
40% identity, 82% coverage: 49:266/267 of query aligns to 42:255/258 of 3t55A
3t44A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with indole glycerol phosphate (igp) amd anthranilate
40% identity, 82% coverage: 49:266/267 of query aligns to 42:255/259 of 3t44A
3t78A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) in complex with 5-fluoroanthranilate
39% identity, 82% coverage: 49:266/267 of query aligns to 42:253/257 of 3t78A
1lbfA Crystal structure of indole-3-glycerol phosphate syntase (igps)with reduced 1-(o-caboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) (see paper)
35% identity, 78% coverage: 49:257/267 of query aligns to 31:240/247 of 1lbfA
Sites not aligning to the query:
1jukA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus in a trigonal crystal form (see paper)
35% identity, 78% coverage: 49:257/267 of query aligns to 31:240/247 of 1jukA
1igsA Indole-3-glycerolphosphate synthase from sulfolobus solfataricus at 2.0 a resolution (see paper)
35% identity, 78% coverage: 49:257/267 of query aligns to 31:240/247 of 1igsA
1a53A Complex of indole-3-glycerolphosphate synthase from sulfolobus solfataricus with indole-3-glycerolphosphate at 2.0 a resolution (see paper)
35% identity, 78% coverage: 49:257/267 of query aligns to 31:240/247 of 1a53A
1vc4B Crystal structure of indole-3-glycerol phosphate synthase (trpc) from thermus thermophilus at 1.8 a resolution (see paper)
41% identity, 78% coverage: 49:257/267 of query aligns to 36:244/254 of 1vc4B
3t40A Crystal structure of mycobacterium tuberculosis indole glycerol phosphate synthase (igps) complex with n-2-carboxyphenyl glycine (cpg)
37% identity, 82% coverage: 49:266/267 of query aligns to 42:241/251 of 3t40A
7etyA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum in complex with reduced 1-(o-carboxyphenylamino)-1- deoxyribulose 5-phosphate (rcdrp) (see paper)
40% identity, 76% coverage: 48:249/267 of query aligns to 36:237/470 of 7etyA
Sites not aligning to the query:
7etxA Crystal structure of bifunctional indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase (trpc) from corynebacterium glutamicum (see paper)
40% identity, 76% coverage: 48:249/267 of query aligns to 38:239/472 of 7etxA
Sites not aligning to the query:
4iwwA Computational design of an unnatural amino acid metalloprotein with atomic level accuracy (see paper)
31% identity, 80% coverage: 49:262/267 of query aligns to 31:245/247 of 4iwwA
3uxdA Designed protein ke59 r1 7/10h with dichlorobenzotriazole (dbt) (see paper)
30% identity, 89% coverage: 26:262/267 of query aligns to 19:245/247 of 3uxdA
4ou1A Crystal structure of a computationally designed retro-aldolase covalently bound to folding probe 1 [(6-methoxynaphthalen-2-yl) (oxiran-2-yl)methanol] (see paper)
29% identity, 80% coverage: 49:262/267 of query aligns to 31:245/247 of 4ou1A
5k7jA Structure of designed zinc binding protein ze2 bound to zn2+ (see paper)
31% identity, 78% coverage: 49:257/267 of query aligns to 31:233/240 of 5k7jA
4a2rA Structure of the engineered retro-aldolase ra95.5-5 (see paper)
28% identity, 80% coverage: 49:262/267 of query aligns to 31:245/247 of 4a2rA
Sites not aligning to the query:
>RR42_RS18310 FitnessBrowser__Cup4G11:RR42_RS18310
MSDILQKILAVKADEVNAARKKRDLPSLRAEAESLRAEPGLAPRGFERALREKIAAGNAG
VIAEVKKASPSKGVLRANFVPEAIAESYATHGAACLSVLTDVNFFQGHAEFLKRARGACP
LPALRKDFMIDLYQVYEARCWGADAILLIVSALDPGLMAELEACAHELGMDVLVEVHGGE
ELDAALRLKTPLLGVNNRNLRTFEVSLDNTLDLLPRIPDDRLVVTESGIIGPDDVHRMRD
ANVHAFLVGEAFMRAPDPGVELARLFA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory