Comparing RR42_RS18505 FitnessBrowser__Cup4G11:RR42_RS18505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
3abiA Crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii (see paper)
30% identity, 62% coverage: 28:274/401 of query aligns to 2:238/349 of 3abiA
Sites not aligning to the query:
Q9UDR5 Alpha-aminoadipic semialdehyde synthase, mitochondrial; LKR/SDH; EC 1.5.1.8; EC 1.5.1.9 from Homo sapiens (Human)
21% identity, 47% coverage: 29:218/401 of query aligns to 482:676/926 of Q9UDR5
5l78A Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain (in NAD+ bound form)
21% identity, 47% coverage: 29:218/401 of query aligns to 2:196/436 of 5l78A
Sites not aligning to the query:
5o1oA Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain with proline bound.
21% identity, 47% coverage: 29:218/401 of query aligns to 2:196/439 of 5o1oA
Sites not aligning to the query:
5o1nA Crystal structure of human aminoadipate semialdehyde synthase, saccharopine dehydrogenase domain with n-[(2s)-2-pyrrolidinylmethyl]- trifluoromethanesulfonamide bound
21% identity, 47% coverage: 29:218/401 of query aligns to 2:196/442 of 5o1nA
Sites not aligning to the query:
>RR42_RS18505 FitnessBrowser__Cup4G11:RR42_RS18505
MTCMTPTGHLDQTGQRTGQNTQARQTPMRVVVLGAGKIGRTIAVMLHDSGDYRVTLVDRE
PTHLEGVPQGIAVRVGDPGQTEDCARLLGGAQAVLNALPFHAAVGVATVAASLGVHYFDL
TEDVAATHAIRRLAEGARCVLMPQCGLAPGFIGVVGNDLAQRFLRGGGELLDLKMRVGAL
PRYPSNALKYNLTWSTEGLINEYCNPCEAIVDGRRVEVPALEGLESFALDGIEYEAFNTS
GGLGTLPETLAGRARGVDYKSIRYPGHCAVMKLLLNDLRLRERRDWMREIFESAIPATQQ
DVVIVFASATGYAASGGKGGRGPLTQASFSARIGGADTVAGHVNAIQLTTAAGICTALDL
VANGELPQAGFVAQEAMPLDVFLANRFGRHYTRHPLQEATV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory