Comparing RR42_RS18605 FitnessBrowser__Cup4G11:RR42_RS18605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 86% coverage: 41:294/295 of query aligns to 27:280/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
30% identity, 72% coverage: 84:294/295 of query aligns to 78:295/296 of P68183
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
25% identity, 63% coverage: 45:230/295 of query aligns to 236:442/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 57% coverage: 64:230/295 of query aligns to 237:427/490 of 4ki0F
>RR42_RS18605 FitnessBrowser__Cup4G11:RR42_RS18605
MKATAAAQQQDTAQGMDYLQSMPRRWVTIYIPLGIFVFVLLFPFYWMAITAFKPDGELLM
RSANPFWVMAPTFAHFKKLLFDTPYPEWLLNTVIVSTISTFASLAASVLAAYAIERLRFQ
GAKQVGLAVFLAYLIPPSILFIPLASIVFQLGLFDTRWALILTYPTFLIPFCTWLLMGYF
RSIPYELEECALIDGATRWEILVKIILPLAVPGLISAGIFAFTLSWNEFIYALTFISSSE
VKTVPVGIVTELIEGDVYHWGALMAGALLGSLPVALVYSFFVEYYVSGMTGAVKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory