Comparing RR42_RS18875 FitnessBrowser__Cup4G11:RR42_RS18875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
35% identity, 78% coverage: 12:109/126 of query aligns to 114:200/200 of 6j2lA
Sites not aligning to the query:
>RR42_RS18875 FitnessBrowser__Cup4G11:RR42_RS18875
MSEQHLSSTDVLARLAAVLESRKPENGGDPDKSYVARLFHKGDDAILKKIGEEATETVMA
AKDARAAGLGPEAVGKVVYEVADLWFHSMVLLARFGLKPADVVNELARREGLSGLEEKAQ
RKADGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory