Comparing RR42_RS19050 FitnessBrowser__Cup4G11:RR42_RS19050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
52% identity, 99% coverage: 4:420/422 of query aligns to 3:416/418 of 4xg1B
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
47% identity, 98% coverage: 8:420/422 of query aligns to 5:391/393 of 4xg1A
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
44% identity, 94% coverage: 26:422/422 of query aligns to 11:404/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
44% identity, 93% coverage: 26:417/422 of query aligns to 9:390/394 of 3c5qA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
40% identity, 96% coverage: 9:414/422 of query aligns to 11:424/434 of 1twiA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
40% identity, 96% coverage: 9:414/422 of query aligns to 15:428/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
40% identity, 96% coverage: 9:414/422 of query aligns to 11:424/434 of 1tufA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
39% identity, 94% coverage: 19:416/422 of query aligns to 4:383/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
39% identity, 94% coverage: 19:416/422 of query aligns to 3:382/385 of 2yxxA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
37% identity, 98% coverage: 3:415/422 of query aligns to 4:417/422 of 6n2aA
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
33% identity, 97% coverage: 10:417/422 of query aligns to 21:444/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
33% identity, 97% coverage: 10:417/422 of query aligns to 22:445/447 of P9WIU7
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 93% coverage: 19:410/422 of query aligns to 17:411/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 93% coverage: 19:410/422 of query aligns to 16:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 93% coverage: 19:410/422 of query aligns to 16:410/421 of 1knwA
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
29% identity, 97% coverage: 5:415/422 of query aligns to 23:453/461 of 8d5rA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
29% identity, 97% coverage: 5:415/422 of query aligns to 23:455/461 of 8d88A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
29% identity, 97% coverage: 5:415/422 of query aligns to 23:455/462 of 8d4iA
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
29% identity, 97% coverage: 5:415/422 of query aligns to 22:451/458 of 8d5dA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
32% identity, 97% coverage: 7:417/422 of query aligns to 20:442/443 of 5x7mA
>RR42_RS19050 FitnessBrowser__Cup4G11:RR42_RS19050
MTAFFHRHDGALSVEHVPLARIAAEYGTPTYVYSRAALTAAYQAYAAACQGRRARVQYAM
KANSNLAILQVFARLGAGFDIVSGGELQRVLAVGGDPRKVVFSGVGKTAAEMELALQHDV
LSFNVESIPELDRLNAVAGRLGKRARVSLRINPDVDAKTHPYISTGLKGNKFGVAFEDVL
PTYRAAAALPHLEVAGIDCHIGSQITEVAPYLEALDKVLDVVEALEREGINLEHIDVGGG
LGITYDDETPPDITGFARTLLDRVAERGHGHREVLFEPGRSLVGNAGVLLTQVEFLKPGA
AKNFCIVDAAMNDLARPAMYEAYHRIEPVQLREAAQATALTYDVVGPVCESGDWLGRDRA
LAVQPGDLLAVMSAGAYGFVMSSNYNTRPRAAEVMVDGDDVHLVRGREHVADLFRDERLL
QG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory