SitesBLAST
Comparing RR42_RS19270 FitnessBrowser__Cup4G11:RR42_RS19270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 94% coverage: 3:247/262 of query aligns to 4:254/255 of 5itvA
- active site: G18 (≠ L17), S141 (= S138), Y154 (= Y151), K158 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ T16), G18 (≠ L17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (= T59), I63 (= I61), N89 (≠ L87), G91 (≠ C89), T139 (≠ F136), S141 (= S138), Y154 (= Y151), K158 (= K155), P184 (= P181), G185 (= G182), I186 (≠ W183), I187 (≠ T184)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
37% identity, 92% coverage: 4:244/262 of query aligns to 3:240/244 of 7krmC
- active site: G18 (= G19), S140 (= S138), Y155 (= Y151)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ T16), G18 (= G19), I19 (≠ A20), D38 (= D37), L39 (≠ I38), A60 (≠ T59), N61 (≠ D60), V62 (≠ I61), N88 (≠ L87), V111 (= V109), S140 (= S138), Y155 (= Y151), K159 (= K155), I188 (≠ T184), T190 (≠ C186)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 93% coverage: 1:244/262 of query aligns to 2:241/244 of 4nbuB
- active site: G18 (≠ L17), N111 (= N110), S139 (= S138), Q149 (≠ R148), Y152 (= Y151), K156 (= K155)
- binding acetoacetyl-coenzyme a: D93 (= D93), K98 (≠ S98), S139 (= S138), N146 (≠ Q145), V147 (≠ T146), Q149 (≠ R148), Y152 (= Y151), F184 (≠ W183), M189 (≠ L188), K200 (≠ R202)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ T16), G18 (≠ L17), I19 (= I18), D38 (= D37), F39 (≠ I38), V59 (≠ T59), D60 (= D60), V61 (≠ I61), N87 (≠ L87), A88 (= A88), G89 (≠ C89), I90 (≠ T90), T137 (≠ F136), S139 (= S138), Y152 (= Y151), K156 (= K155), P182 (= P181), F184 (≠ W183), T185 (= T184), T187 (≠ C186), M189 (≠ L188)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
39% identity, 92% coverage: 7:247/262 of query aligns to 7:244/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G13), I16 (= I18), D34 (= D37), L35 (≠ I38), R36 (≠ D39), V53 (≠ T59), L55 (≠ I61), N81 (≠ L87), A82 (= A88), A83 (≠ C89), Y146 (= Y151)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 92% coverage: 7:247/262 of query aligns to 6:238/240 of 2d1yA
- active site: G16 (≠ L17), S135 (= S138), N145 (≠ R148), Y148 (= Y151), K152 (= K155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ T16), I17 (= I18), D36 (= D37), L37 (≠ I38), R38 (≠ D39), V55 (≠ T59), D56 (= D60), L57 (≠ I61), N83 (≠ L87), A84 (= A88), A85 (≠ C89), I86 (≠ T90), V133 (≠ F136), S135 (= S138), Y148 (= Y151), K152 (= K155), P178 (= P181), G179 (= G182), I181 (≠ T184), T183 (≠ C186), A185 (≠ L188), V186 (≠ M189)
1nfqA Rv2002 gene product from mycobacterium tuberculosis (see paper)
40% identity, 93% coverage: 4:247/262 of query aligns to 4:239/244 of 1nfqA
- active site: G17 (≠ L17), S139 (= S138), Y152 (= Y151), K156 (= K155)
- binding Androsterone: L91 (= L87), E141 (≠ S140), C149 (≠ R148), Y152 (= Y151), V193 (= V192), I197 (≠ T200), F198 (≠ D201)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R16 (≠ T16), G17 (≠ L17), M18 (≠ I18), D37 (= D37), L39 (≠ D39), L59 (≠ T59), D60 (= D60), V61 (≠ I61), N87 (vs. gap), A88 (vs. gap), I137 (≠ F136), S139 (= S138), Y152 (= Y151), K156 (= K155), P182 (= P181), V185 (≠ T184), T187 (≠ C186), P188 (≠ R187), M189 (≠ L188), T190 (≠ M189)
1nffA Crystal structure of rv2002 gene product from mycobacterium tuberculosis (see paper)
40% identity, 93% coverage: 4:247/262 of query aligns to 4:239/244 of 1nffA
- active site: G17 (≠ L17), S139 (= S138), Y152 (= Y151), K156 (= K155)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), R16 (≠ T16), G17 (≠ L17), M18 (≠ I18), D37 (= D37), I38 (= I38), L39 (≠ D39), L59 (≠ T59), D60 (= D60), V61 (≠ I61), N87 (vs. gap), A88 (vs. gap), G89 (vs. gap), I90 (vs. gap), I137 (≠ F136), S139 (= S138), Y152 (= Y151), K156 (= K155), P182 (= P181), V185 (≠ T184), T187 (≠ C186), P188 (≠ R187), M189 (≠ L188), T190 (≠ M189)
P9WGT1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase; NADH-dependent 3alpha, 20beta-hydroxysteroid dehydrogenase; EC 1.1.1.53 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 93% coverage: 4:247/262 of query aligns to 5:240/260 of P9WGT1
- I6 (≠ R5) mutation to T: Maximal improvement in solubility; when associated with M-47 and K-69.
- RGM 17:19 (≠ TLI 16:18) binding
- D38 (= D37) binding
- V47 (≠ A46) mutation to M: Maximal improvement in solubility; when associated with T-6 and K-69.
- DV 61:62 (≠ DI 60:61) binding
- T69 (≠ A68) mutation to K: Maximal improvement in solubility; when associated with T-6 and M-47.
- N88 (vs. gap) binding
- S140 (= S138) mutation to A: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- Y153 (= Y151) binding ; mutation to F: Complete loss of both oxidation of androsterone and reduction of progesterone; when associated with T6; M-47 and K-69.
- K157 (= K155) binding
- 183:191 (vs. 181:189, 22% identical) binding
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
34% identity, 93% coverage: 4:247/262 of query aligns to 5:251/252 of Q6WVP7
Sites not aligning to the query:
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 93% coverage: 4:247/262 of query aligns to 5:226/227 of 5itvD
- active site: G18 (≠ L17), S141 (= S138), Y154 (= Y151), K158 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ T16), G18 (≠ L17), I19 (= I18), D38 (= D37), I39 (= I38), T61 (= T59), D62 (= D60), I63 (= I61), N89 (≠ L87), T139 (≠ F136), S141 (= S138), Y154 (= Y151), K158 (= K155), P184 (= P181), G185 (= G182), I187 (≠ M189)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
39% identity, 94% coverage: 2:248/262 of query aligns to 1:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (≠ L17), I17 (= I18), D36 (= D37), L37 (≠ I38), C61 (≠ T59), D62 (= D60), V63 (≠ I61), N89 (≠ L87), A90 (= A88), T140 (≠ F136), S142 (= S138), Y155 (= Y151), K159 (= K155), A186 (≠ G182), V187 (≠ W183)
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 93% coverage: 4:247/262 of query aligns to 4:250/251 of 1zk1A
- active site: G17 (≠ L17), S142 (= S138), Y155 (= Y151), K159 (= K155)
- binding 1-phenylethanone: A93 (≠ Y91), N95 (≠ D93), Y155 (= Y151), Y189 (≠ W183)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ T16), I18 (= I18), D37 (= D37), H61 (≠ T59), D62 (= D60), S63 (≠ I61), N89 (≠ L87), A90 (= A88), I92 (≠ T90), M140 (≠ F136), Y155 (= Y151), G188 (= G182), I190 (≠ T184), L194 (= L188)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
33% identity, 93% coverage: 4:247/262 of query aligns to 4:250/251 of 1zjzA
- active site: G17 (≠ L17), S142 (= S138), Y155 (= Y151), K159 (= K155)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), L16 (≠ T16), I18 (= I18), D37 (= D37), D62 (= D60), N89 (≠ L87), A90 (= A88), G91 (≠ C89), I92 (≠ T90), Y155 (= Y151), G188 (= G182), I190 (≠ T184), L194 (= L188)
- binding (1r)-1-phenylethanol: A93 (≠ Y91), N95 (≠ D93), L152 (≠ R148), Y155 (= Y151)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
33% identity, 93% coverage: 4:247/262 of query aligns to 4:250/251 of 1zjyA
- active site: G17 (≠ L17), S142 (= S138), Y155 (= Y151), K159 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G13), L16 (≠ T16), G17 (≠ L17), I18 (= I18), D37 (= D37), D62 (= D60), N89 (≠ L87), A90 (= A88), G91 (≠ C89), I92 (≠ T90), Y155 (= Y151), G188 (= G182), I190 (≠ T184), L194 (= L188)
- binding (1r)-1-phenylethanol: A93 (≠ Y91), N95 (≠ D93), L152 (≠ R148), Y155 (= Y151), Y189 (≠ W183)
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
33% identity, 92% coverage: 3:244/262 of query aligns to 4:258/263 of 3ai2A
- active site: G18 (≠ L17), S144 (= S138), Y157 (= Y151), K161 (= K155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (≠ A15), S17 (≠ T16), G18 (≠ L17), I19 (= I18), A38 (≠ D37), R39 (≠ I38), Q40 (≠ D39), V64 (≠ T59), D65 (= D60), V66 (≠ I61), N92 (≠ L87), G94 (≠ C89), N142 (≠ F136), Y157 (= Y151), K161 (= K155), P187 (= P181), I190 (≠ T184), T192 (vs. gap), W195 (= W185)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
34% identity, 94% coverage: 4:248/262 of query aligns to 4:251/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S138), I143 (= I139), Y155 (= Y151), F205 (≠ R199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ A15), L16 (≠ T16), G17 (≠ L17), I18 (= I18), R38 (≠ I38), H39 (≠ D39), D62 (= D60), A63 (≠ I61), N89 (≠ L87), A90 (= A88), V112 (= V109), M140 (≠ F136), S142 (= S138), Y155 (= Y151), K159 (= K155), P187 (= P181), P189 (≠ W183), I190 (≠ T184), T192 (≠ C186), P193 (≠ R187), L194 (= L188)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
34% identity, 94% coverage: 4:248/262 of query aligns to 6:253/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S138), I145 (= I139), E146 (≠ S140), Y157 (= Y151), V197 (≠ M189), F207 (≠ R199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (≠ A15), I20 (= I18), R40 (≠ I38), H41 (≠ D39), D64 (= D60), A65 (≠ I61), N91 (≠ L87), A92 (= A88), V114 (= V109), M142 (≠ F136), S144 (= S138), Y157 (= Y151), K161 (= K155), P189 (= P181), G190 (= G182), P191 (≠ W183), I192 (≠ T184), T194 (≠ C186), P195 (≠ R187), L196 (= L188)
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
33% identity, 92% coverage: 3:244/262 of query aligns to 4:258/263 of 3ai3C
- active site: G18 (≠ L17), S144 (= S138), Y157 (= Y151), K161 (= K155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (≠ A15), S17 (≠ T16), G18 (≠ L17), I19 (= I18), A38 (≠ D37), R39 (≠ I38), Q40 (≠ D39), R43 (≠ G42), D65 (= D60), V66 (≠ I61), N92 (≠ L87), G94 (≠ C89), N142 (≠ F136), Y157 (= Y151), K161 (= K155), P187 (= P181), G188 (= G182), I190 (≠ T184), T192 (vs. gap), W195 (= W185)
- binding alpha-L-sorbopyranose: A252 (≠ D238), F254 (≠ A240)
- binding L-sorbose: G96 (≠ Y91), E154 (≠ R148), Y157 (= Y151), W195 (= W185)
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
33% identity, 92% coverage: 3:244/262 of query aligns to 4:258/263 of 3ai3A
- active site: G18 (≠ L17), S144 (= S138), Y157 (= Y151), K161 (= K155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (≠ A15), S17 (≠ T16), G18 (≠ L17), I19 (= I18), A38 (≠ D37), R39 (≠ I38), Q40 (≠ D39), R43 (≠ G42), V64 (≠ T59), D65 (= D60), V66 (≠ I61), N92 (≠ L87), G94 (≠ C89), N142 (≠ F136), S144 (= S138), Y157 (= Y151), K161 (= K155), P187 (= P181), G188 (= G182), I190 (≠ T184), T192 (vs. gap), W195 (= W185)
- binding L-sorbose: G96 (≠ Y91), S144 (= S138), L151 (≠ Q145), E154 (≠ R148), Y157 (= Y151), G188 (= G182)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
40% identity, 92% coverage: 4:244/262 of query aligns to 4:237/241 of 5t2uA
- active site: G17 (≠ L17), T135 (≠ S138), T145 (≠ R148), Y148 (= Y151), K152 (= K155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (≠ L17), R38 (≠ I38), D39 (= D39), R42 (≠ G42), D60 (= D60), L61 (≠ I61), N83 (≠ L87), A84 (= A88), Y87 (= Y91), I133 (≠ F136), T135 (≠ S138), Y148 (= Y151), K152 (= K155), P178 (= P181), P180 (≠ W183), T181 (= T184), T183 (≠ C186), T185 (≠ L188), T186 (≠ M189)
Query Sequence
>RR42_RS19270 FitnessBrowser__Cup4G11:RR42_RS19270
MKGLRDKVAIISGGATLIGAGVASAFVEAGTRVAILDIDASGGERAAAALGERALFVHTD
ITDDAQVAAAVARVSQHFGGVDYLVNLACTYLDDGFKSARRDWLAALDVNVVSGVMLAQA
VHPAMRARGGGAIVNFTSISANVGQTGRWLYPASKAAIRQLTRSMAMDLAPDGIRVNAVS
PGWTWCRLMDEVSGGNRERTDRVAADFHLLGRVGEPDEVAQVVLFLCSDHASFVTGADYA
VDGGYSAMGPEQNVPAIPRLAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory