SitesBLAST
Comparing RR42_RS19610 FitnessBrowser__Cup4G11:RR42_RS19610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
25% identity, 75% coverage: 70:391/432 of query aligns to 57:394/446 of A0A0H2VG78
- R102 (= R123) mutation to A: Loss of transport activity.
- I105 (≠ Q126) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E143) mutation to A: Loss of transport activity.
- Q137 (= Q158) mutation to A: Loss of transport activity.
- Q250 (vs. gap) mutation to A: Loss of transport activity.
- Q251 (vs. gap) mutation to A: Loss of transport activity.
- N256 (vs. gap) mutation to A: Loss of transport activity.
- W357 (≠ A358) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
27% identity, 45% coverage: 28:223/432 of query aligns to 56:249/444 of Q8NLB7
- D57 (= D29) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R81) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
26% identity, 70% coverage: 71:374/432 of query aligns to 80:391/448 of Q51955
- G85 (= G76) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D80) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G83) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R123) mutation to A: Abolishes 4-HBA transport.
- E144 (= E143) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R190) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D303) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ K308) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R369) mutation to A: Strong decrease in 4-HBA transport.
Sites not aligning to the query:
- 41 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 44 mutation D->A,N: Abolishes 4-HBA transport.; D→E: Decrease in 4-HBA transport.
- 398 R→A: Abolishes 4-HBA transport.
- 444 H→A: No change in 4-HBA transport and chemotaxis.
O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
24% identity, 75% coverage: 71:392/432 of query aligns to 162:484/554 of O15245
- S189 (≠ G98) to L: no changes in MPP(+) uptake; dbSNP:rs34104736
- G220 (≠ A137) to V: affects transporter activity; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs36103319
- Y240 (≠ F165) mutation to F: Decreased TEA uptake.
- P283 (≠ G203) to L: in dbSNP:rs4646277; mutation to A: Decreased TEA uptake.
- R287 (= R207) to G: in dbSNP:rs4646278
- P341 (≠ I252) to L: affects transporter activity; reduction of TEA uptake; reduction o MPP(+) uptake when associated with V-408; largely localized to the plasma membrane; dbSNP:rs2282143
- R342 (≠ L253) to H: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34205214
- Y361 (≠ K270) mutation to F: Decreased TEA uptake.
- Y376 (vs. gap) mutation to F: Decreased TEA uptake.
- G401 (= G306) to S: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; no MPP(+) uptake when associated with L-160; dbSNP:rs34130495
- M408 (vs. gap) to V: does not affect transporter activity; no changes in MPP(+) uptake when associated with F-14; no changes in MPP(+) uptake when associated with F-85; no changes in MPP(+) uptake when associated with L-189; no changes in MPP(+) uptake when associated with H-342; no changes in MPP(+) uptake when associated with M-420 del; no changes in MPP(+) uptake when associated with I-440; no changes in MPP(+) uptake when associated with I-461; no changes in MPP(+) uptake when associated with M-488; reduction of MPP uptake when associated with C-61; no MPP(+) uptake when associated with V-220; reduction of MPP(+) uptake when associated with L-341; no MPP(+) uptake when associated with S-401; no MPP(+) uptake when associated with R-465; dbSNP:rs628031
- M420 (≠ G319) natural variant: Missing (reduction of serum O-isobutanoyl-(R)-carnitine levels; no change in MPP(+) uptake; no changes in MPP(+) uptake when associated with V-408; dbSNP:rs72552763)
- M440 (≠ L345) to I: in dbSNP:rs35956182
- V461 (= V368) to I: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs34295611
- G465 (= G372) to R: reduction of the localization to the basolateral membrane; no MPP(+) uptake when associated with V-408; dbSNP:rs34059508; mutation to A: No changes in MPP(+) uptake.
Sites not aligning to the query:
- 14 S → F: exclusively found in the African American population; increased MPP(+) uptake when associated with V-408; dbSNP:rs34447885
- 24 I→L: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 28 L→I: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 31 A→S: No change in fenoterol uptake. No change in trospium uptake. No change in terbutaline uptake.
- 32 F→L: No change in fenoterol uptake. Decreased trospium uptake. Decreased trospium affinity.
- 36 C→Y: Increased fenoterol uptake. Increased fenoterol affinity. No change in trospium uptake. No change in terbutaline uptake. No change in terbutaline affinity.
- 41 F → L: in dbSNP:rs2297373
- 61 R → C: affects transporter activity; reduction of MPP(+) uptake; reduction of serum O-isobutanoyl-(R)-carnitine levels; reduction of MPP(+) uptake when associated with V-408; dbSNP:rs12208357
- 85 L → F: no changes in MPP(+) uptake; when associated with V-408; dbSNP:rs35546288
- 88 C → R: affects transporter activity; reduction of MPP(+), serotonin and TEA uptake; dbSNP:rs55918055
- 160 L → F: no changes in both MPP(+) and TEA uptake; abolishes MPP(+) uptake when associated with S-401; largely localized to the plasma membrane; dbSNP:rs683369
- 488 R → M: no changes in MPP(+) uptake when associated with V-408; dbSNP:rs35270274
8et9A Cryo-em structure of the organic cation transporter 2 in complex with 1-methyl-4-phenylpyridinium (see paper)
34% identity, 31% coverage: 56:189/432 of query aligns to 149:262/517 of 8et9A
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 54% coverage: 80:311/432 of query aligns to 93:344/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
7sptA Crystal structure of exofacial state human glucose transporter glut3 (see paper)
24% identity, 46% coverage: 56:253/432 of query aligns to 65:258/470 of 7sptA
Sites not aligning to the query:
5c65A Structure of the human glucose transporter glut3 / slc2a3
24% identity, 46% coverage: 56:253/432 of query aligns to 61:254/457 of 5c65A
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
37% identity, 19% coverage: 59:138/432 of query aligns to 154:223/556 of O08966
Sites not aligning to the query:
- 32 L→F: Increased trospium uptake. Increased trospium affinity. No change in fenoterol uptake.
- 36 Y→C: Decreased fenoterol uptake. Decreased fenoterol affinity. No change in trospium uptake. No change in terbutaline affinity.
8et8A Cryo-em structure of the organic cation transporter 1 in complex with verapamil (see paper)
23% identity, 73% coverage: 59:373/432 of query aligns to 152:465/532 of 8et8A
- binding (2S)-2-(3,4-dimethoxyphenyl)-5-{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino}-2-(propan-2-yl)pentanenitrile: K213 (≠ G131), W216 (≠ V134), Q240 (≠ M166), W353 (vs. gap), Y360 (≠ K270), F378 (= F281), S381 (≠ T284), E385 (≠ G288), C449 (≠ L349)
Sites not aligning to the query:
8et7A Cryo-em structure of the organic cation transporter 1 in complex with diphenhydramine (see paper)
23% identity, 73% coverage: 59:373/432 of query aligns to 152:465/532 of 8et7A
Sites not aligning to the query:
4zw9A Crystal structure of human glut3 bound to d-glucose in the outward- occluded conformation at 1.5 angstrom (see paper)
24% identity, 46% coverage: 56:253/432 of query aligns to 65:258/470 of 4zw9A
Sites not aligning to the query:
7spsA Crystal structure of human glucose transporter glut3 bound with exofacial inhibitor sa47 (see paper)
24% identity, 46% coverage: 56:253/432 of query aligns to 62:255/468 of 7spsA
Sites not aligning to the query:
- binding methyl N-[(2-{4-[4-(5-fluoro-2-methoxyphenyl)piperazin-1-yl]-1H-pyrazolo[3,4-d]pyrimidin-1-yl}phenyl)methyl]-beta-alaninate: 21, 25, 29, 278, 286, 308, 312, 374, 375, 406, 407, 410
7crzA Crystal structure of human glucose transporter glut3 bound with c3361 (see paper)
24% identity, 46% coverage: 56:253/432 of query aligns to 63:256/469 of 7crzA
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: 26, 278, 279, 284, 313, 375, 384, 411, 412, 415
P11169 Solute carrier family 2, facilitated glucose transporter member 3; Glucose transporter type 3, brain; GLUT-3 from Homo sapiens (Human) (see paper)
24% identity, 46% coverage: 56:253/432 of query aligns to 65:258/496 of P11169
Sites not aligning to the query:
- 277:279 Important for selectivity against fructose; QLS→HVA: Confers moderate fructose transport activity.
- 280:281 binding
- 286 binding
- 315 binding
- 378 binding
- 386 binding
Q63089 Solute carrier family 22 member 1; Organic cation transporter 1; rOCT1 from Rattus norvegicus (Rat) (see 4 papers)
36% identity, 19% coverage: 59:138/432 of query aligns to 154:223/556 of Q63089
- C155 (≠ T60) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- C179 (≠ A87) mutation to A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; S-322; A-358; A-418; S-437; A-470 and A-474.
- M212 (≠ F128) mutation to L: No change in TEA and MPP(+) uptake.
- V213 (vs. gap) mutation to G: Decreased TEA uptake. No change in MPP(+) uptake.
- S214 (= S129) mutation to G: Decreased TEA and MPP(+) uptake.
- K215 (≠ A130) mutation to Q: Loss of TEA and MPP(+) uptake activity.; mutation to R: Loss of TEA and MPP(+) uptake activity.
- G216 (= G131) mutation to A: Decreased TEA and MPP(+) uptake.
- S217 (≠ G132) mutation to G: No change in TEA and MPP(+) uptake.
- W218 (≠ E133) mutation to F: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. No change in TEA and MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, histamine, serotonin, TEA and MPP(+) uptake. Decreased TEA affinity. No change in MPP(+) affinity. Decreased TEA and MPP(+) Vmax.; mutation to Y: Decreased guanidine, histamine, serotonin and TEA uptake. No change in MPP(+) uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- V219 (= V134) mutation to L: No change in TEA and MPP(+) uptake.
- S220 (≠ G135) mutation to I: Decreased TEA and MPP(+) uptake.
- G221 (= G136) mutation to A: Decreased TEA and MPP(+) uptake.
- Y222 (≠ A137) mutation to F: No change in guanidine, histamine, serotonin, TEA and MPP(+) uptake. Increased TEA affinity. No change in MPP(+) affinity. Decreased TEA Vmax. No change in MPP(+) Vmax.; mutation to L: Decreased guanidine, serotonin, TEA and MPP(+) uptake. No change in histamine uptake. Increased TEA and MPP(+) affinity. Decreased TEA and MPP(+) Vmax.
- T223 (= T138) mutation to I: Decreased TEA uptake. No change in MPP(+) uptake.
Sites not aligning to the query:
- 26 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-155; A-179; S-322; A-358; A-418; S-437; A-470 and A-474.
- 224 L→V: Decreased TEA and MPP(+) uptake.
- 225 I→G: No change in TEA and MPP(+) uptake.
- 226 T→A: Decreased TEA uptake. No change in MPP(+) uptake.
- 227 E→D: Loss of TEA and MPP(+) uptake activity.; E→Q: Loss of TEA and MPP(+) uptake activity.
- 228 F→I: No change in TEA and MPP(+) uptake.
- 229 V→A: Decreased TEA and MPP(+) uptake.; V→L: Loss of TEA and MPP(+) uptake activity.
- 286 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-292; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-292; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-292; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-292; A-296; A-328 and A-550.
- 292 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-296; A-328 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-296; A-328 and A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-296; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-296; A-328 and A-550.
- 296 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-328; A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-328; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-328 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-328 and A-550.
- 322 C→S: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with M-451. Choline affinity is increased fivefold by MMTS. Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; A-358; A-418; S-437; A-470 and A-474. Choline affinity is increased four- to fivefold; when associated with M-451.
- 328 S→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. No effect of PKA activation on ASP uptake. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-550. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-550. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-550. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-550.
- 358 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-418; S-437; A-470 and A-474.
- 418 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; S-437; A-470 and A-474.
- 437 C→S: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-470 and A-474.
- 451 C→M: Reduces the activation by MMTS. Abolishes the activation by MMTs; when associated with S-322. Abolishes the effect of MMTs on choline-induced currents. Choline affinity is not influenced by MMTS. Choline affinity is increased four- to fivefold; when associated with S-322.
- 470 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-474.
- 474 C→A: Choline affinity is increased fourfold by MMTS; when associated with A-26; A-155; A-179; S-322; A-358; A-418; A-437 and A-470.
- 475 D→E: Decreased MPP(+) uptake, no change in MPP(+) affinity. Decreased NMN uptake, increased NMN affinity. Decreased choline uptake, increased choline affinity.; D→N: Decreased MPP(+) uptake.; D→R: Decreased MPP(+) uptake.
- 550 T→A: No effect of PKC-induced stimulation on ASP uptake. No effect of PKC-induced stimulation on ASP uptake; when associated with A-286; A-292; A-296; A-328. Significant increase of the ASP uptake by PKA activation. No effect of PKA activation on ASP uptake; when associated with A-286; A-292; A-296 and A-328. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition. Significant reduction of ASP uptake by p56(lck) tyrosine kinase-induced inhibition; when associated with A-286; A-292; A-296; A-328. No significant effect on trafficking from intracellular pools to the cell membrane; when associated with A-286; A-292; A-296 and A-328. suppresses phosphorylation by PKC; when associated with A-286; A-292; A-296 and A-328.
Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
38% identity, 15% coverage: 62:127/432 of query aligns to 157:211/555 of Q9R0W2
Sites not aligning to the query:
- 451 Involved in recognition of organic cations and participates in structural changes that occur during translocation of organic cations; C→M: Transport activity strongly reduced.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
21% identity, 74% coverage: 60:378/432 of query aligns to 178:498/616 of P36035
- K338 (= K229) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7wsmA Cryo-em structure of human glucose transporter glut4 bound to cytochalasin b in lipid nanodiscs (see paper)
26% identity, 46% coverage: 46:244/432 of query aligns to 53:247/464 of 7wsmA
Sites not aligning to the query:
Query Sequence
>RR42_RS19610 FitnessBrowser__Cup4G11:RR42_RS19610
MPQVHEISKAQRRKAILAATIGNGLEWFDFTVYSFFALIIAKLFFPTGNDLTSFLLTVAT
FGVGFFMRPVGAIVLGVYADRVGRKAALTLTILMMALGTAIIGLAPTYSSIGLWAPALIV
LARLIQGFSAGGEVGGATAFLIEHAPDEERGAYASWQQASQGISFMLGAAMGALVINGLE
PEQIDAWGWRIPFLFGLLIGPVGMYIRSHLEEPPAFEARRAERAASKVKFSPLTQVLRDH
PREVLAGLGVTILWTVCTYVLVFYMPSYAKQQLGLPLGATFQSTALCGAIILVLCPLMGM
LSDRVGRKRMLGTVALIIGVLAYPLFHWLNVSPTTQTLLMVQVILGILLAAFTGPAPAVL
AEQFPTEVRSTGLSLAYNFAVTIFGGFAPLIVTWLIASSGSKLAPAYYVIAAAAISFVAL
LFMHDRTGKPLQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory