Comparing RR42_RS19695 FitnessBrowser__Cup4G11:RR42_RS19695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
1a56A Primary sequence and solution conformation of ferricytochromE C-552 from nitrosomonas europaea, nmr, mean structure refined with explicit hydrogen bond constraints (see paper)
54% identity, 70% coverage: 28:103/109 of query aligns to 3:78/81 of 1a56A
P00099 Cytochrome c-551; Cytochrome C8; Cytochrome c551 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 4 papers)
45% identity, 95% coverage: 1:104/109 of query aligns to 1:102/104 of P00099
Sites not aligning to the query:
5xecC Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
50% identity, 72% coverage: 27:104/109 of query aligns to 2:78/80 of 5xecC
2d0sA Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus (see paper)
52% identity, 71% coverage: 27:103/109 of query aligns to 2:76/79 of 2d0sA
2exvA Crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa (see paper)
51% identity, 70% coverage: 29:104/109 of query aligns to 6:80/82 of 2exvA
351cA Structure of cytochrome c551 from p. Aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms (see paper)
53% identity, 71% coverage: 28:104/109 of query aligns to 4:80/82 of 351cA
5xecA Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
51% identity, 71% coverage: 28:104/109 of query aligns to 4:80/82 of 5xecA
1corA Investigation of the solution conformation of cytochromE C-551 from pseudomonas stutzeri (see paper)
49% identity, 64% coverage: 35:104/109 of query aligns to 12:80/82 of 1corA
Sites not aligning to the query:
5aurA Hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region (see paper)
47% identity, 72% coverage: 27:104/109 of query aligns to 2:81/83 of 5aurA
6kq1A Crystal structure of cytochrome c551 from pseudomonas sp. Strain mt-1.
49% identity, 64% coverage: 35:104/109 of query aligns to 12:80/82 of 6kq1A
Sites not aligning to the query:
1cchA The solution conformation of cytochromE C-551 from p.Stutzeri zobell determined by nmr+ (see paper)
50% identity, 64% coverage: 35:104/109 of query aligns to 12:80/82 of 1cchA
4xxlA Crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 (see paper)
36% identity, 78% coverage: 20:104/109 of query aligns to 1:89/92 of 4xxlA
>RR42_RS19695 FitnessBrowser__Cup4G11:RR42_RS19695
MKQFVIATLMLACAASANAAVDAAKAQEIANKNACMGCHQVDKKLVGPAYKDVAAKYKGD
KNALATLTKKVKGGGSGVWGPVPMPANAALSDADLKTVVEWVLAGAPAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory