SitesBLAST
Comparing RR42_RS19790 FitnessBrowser__Cup4G11:RR42_RS19790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
27% identity, 85% coverage: 31:431/473 of query aligns to 11:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
27% identity, 85% coverage: 31:431/473 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K209), G195 (≠ F213), R282 (≠ K300)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A289), S272 (= S290), S273 (= S291), M307 (≠ L324), T310 (≠ F327), G353 (= G370), A354 (≠ S371), R394 (= R405), T395 (≠ A406)
Sites not aligning to the query:
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
27% identity, 85% coverage: 31:431/473 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A289), S275 (= S290), S276 (= S291), T313 (≠ F327), G353 (= G367), V354 (≠ I368), A357 (≠ S371), G358 (≠ A372), D394 (≠ G402), R397 (= R405), T398 (≠ A406)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K209), G198 (≠ F213), Y202 (≠ L217)
- binding sodium ion: Y87 (≠ F100), T90 (≠ V103), S91 (≠ T104), S276 (= S291), G305 (= G319), A306 (≠ Y320), T307 (≠ S321), N309 (= N323), N309 (= N323), M310 (≠ L324), D311 (= D325), S348 (= S362), I349 (≠ K363), G350 (= G364), T351 (≠ A365), N401 (= N409), V402 (≠ L410), D405 (≠ N413)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
27% identity, 85% coverage: 31:431/473 of query aligns to 13:423/426 of 6xwnB
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 84% coverage: 31:429/473 of query aligns to 15:421/425 of O59010
- S65 (≠ V75) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A289) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 289:291) binding
- M311 (≠ L324) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F327) binding
- V355 (≠ I368) binding
- D394 (≠ G402) binding
- M395 (≠ I403) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R405) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N409) binding
- D405 (≠ N413) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
26% identity, 83% coverage: 31:424/473 of query aligns to 6:407/407 of 2nwwA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
27% identity, 85% coverage: 31:431/473 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A289), S265 (= S291), M299 (≠ L324), T302 (≠ F327), T340 (≠ A365), G342 (= G367), V343 (≠ I368), G347 (≠ A372), D383 (≠ G402), R386 (= R405), T387 (≠ A406), N390 (= N409)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E48), V212 (≠ L238), A216 (≠ G242)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 83% coverage: 31:424/473 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G79), V83 (= V97), I157 (≠ L181), Y164 (≠ L188), K193 (= K209), T305 (≠ S321), I306 (≠ F322), I347 (≠ K363)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V32), M199 (≠ I215), S275 (= S291), T311 (≠ F327), G356 (≠ A372), L384 (= L395), D391 (≠ G402), R394 (= R405)
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 83% coverage: 31:424/473 of query aligns to 15:416/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L56), F46 (≠ L56), P75 (≠ E85), L91 (≠ V102), F95 (≠ I106), L130 (≠ M151), I133 (≠ F154), I159 (= I180), Y167 (≠ L188), K196 (= K209), G200 (≠ F213), I207 (≠ L220), F210 (≠ L223), L250 (≠ V263), I262 (= I275), M269 (≠ L282), T334 (≠ A347), V335 (≠ L348), G336 (= G349), T340 (≠ G353), L343 (≠ A356), M399 (≠ V407)
- binding aspartic acid: S277 (= S290), S278 (= S291), T314 (≠ F327), G354 (= G367), A358 (≠ S371), G359 (≠ A372), D394 (≠ G402), R397 (= R405), T398 (≠ A406)
- binding sodium ion: Y89 (≠ F100), T92 (≠ V103), S93 (≠ T104), G306 (= G319), T308 (≠ S321), N310 (= N323), N310 (= N323), M311 (≠ L324), D312 (= D325), S349 (= S362), I350 (≠ K363), T352 (≠ A365), N401 (= N409), V402 (≠ L410), D405 (≠ N413)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 83% coverage: 31:424/473 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S291), M303 (≠ L324), T306 (≠ F327), A345 (≠ H366), G346 (= G367), V347 (≠ I368), G351 (≠ A372), D386 (≠ G402), C389 (≠ R405), T390 (≠ A406), N393 (= N409)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 83% coverage: 31:424/473 of query aligns to 7:408/409 of 6bavA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 80% coverage: 57:433/473 of query aligns to 57:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V89), G89 (= G90), G92 (= G93), A95 (= A96), V96 (= V97), Y99 (≠ F100), M163 (≠ I180), F167 (≠ C184), F293 (≠ L314), V297 (≠ T318)
- binding aspartic acid: S268 (= S290), S269 (= S291), T306 (≠ F327), G346 (= G367), I347 (= I368), A350 (≠ S371), G351 (≠ A372), D380 (≠ G402), R383 (= R405), T384 (≠ A406)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
25% identity, 83% coverage: 31:424/473 of query aligns to 7:396/396 of 6bmiA
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 79% coverage: 57:432/473 of query aligns to 49:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I80), S80 (≠ V89), G81 (= G90), G84 (= G93), Y91 (≠ F100), M156 (≠ I180), F160 (≠ C184), F286 (≠ L314), V290 (≠ T318)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V72), I148 (≠ V172), S262 (= S291), S263 (≠ D292), A292 (≠ Y320), T293 (≠ S321), M296 (≠ L324), T299 (≠ F327), G329 (= G364), A336 (≠ S371), G337 (≠ A372), D366 (≠ G402), R369 (= R405), N373 (= N409)
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 94% coverage: 22:464/473 of query aligns to 43:538/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ G170) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 93% coverage: 22:461/473 of query aligns to 43:535/542 of P43003
- S363 (≠ A289) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 289:291) binding
- T396 (≠ S321) binding
- T402 (≠ F327) binding
- IPQAG 443:447 (≠ IPGSA 368:372) binding
- D476 (≠ G402) binding
- R477 (≠ I403) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N409) binding
- Y523 (≠ F449) mutation to F: No effect on activity.
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 75% coverage: 57:413/473 of query aligns to 47:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S290), S281 (= S291), T318 (≠ F327), G363 (≠ A372), M367 (≠ L376), V385 (≠ L395), D388 (= D398), R395 (= R405), T396 (≠ A406)
- binding dodecyl beta-D-glucopyranoside: W389 (= W399)
- binding cholesterol hemisuccinate: R80 (= R91), R84 (≠ K95), I95 (= I106), I252 (≠ V259)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
29% identity, 75% coverage: 57:413/473 of query aligns to 46:404/425 of 7xr4A
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
30% identity, 75% coverage: 57:413/473 of query aligns to 39:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ V75), L58 (≠ V76), L65 (≠ A83), V339 (≠ K363), G340 (= G364), S343 (≠ G367), I344 (= I368)
- binding cholesterol: W188 (≠ K216), I227 (≠ V252), F250 (= F272), W257 (≠ L282), M379 (≠ A404), S382 (≠ V407)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S291), M300 (≠ L324), T303 (≠ F327), Y306 (= Y330), G348 (≠ A372), L349 (≠ I373), M352 (≠ L376), I366 (≠ L391), L369 (≠ V394), V370 (≠ L395), D373 (= D398), D377 (≠ G402), R380 (= R405), T381 (≠ A406), N384 (= N409)
Sites not aligning to the query:
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
26% identity, 85% coverage: 57:457/473 of query aligns to 82:530/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Query Sequence
>RR42_RS19790 FitnessBrowser__Cup4G11:RR42_RS19790
MHPAVQQRPASGRPHAAPSRFSRFFRSLFGQVLVALVLGTALGLLFPEFAAKLKPLGDAF
IKLIKMLIGPIVFCVVVAGICGAGELKKVGRVGIKAVLYFEVVTTIALALGIALAYIFHP
GTGMNVNPASLDASAMSAYVDTAQKVKSAGMVDFLLKLIPSTVMGAFASGDVLQVLLVSI
LFGCALSLVGERGQPLVTIIDTFSHTLFKMMGFIIKLAPLGVLGAVAFTVGKYGIGSLKQ
LGYLVLVFYGAVALFVMVVLGTVMRLCGFSVFKLIRYLRAELLVVLGTASSDSVLPQVMK
KLEFLGIKKSVVGLVIPTGYSFNLDAFSIYLTLAAVFIAQATNTPLALGDLLGILAVALV
TSKGAHGIPGSAIVILAATLSAHPAIPAIGLVLVLSVDWFIGIARAVGNLIGNCVATVVV
AAWEKDIDRARAHDVLNGRIDASDLEAGFAPAPHEAALATPGASPLPGAAAGR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory