Comparing RR42_RS19905 FitnessBrowser__Cup4G11:RR42_RS19905 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
Q57763 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
44% identity, 88% coverage: 12:121/125 of query aligns to 5:114/124 of Q57763
Q9WZC3 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
40% identity, 88% coverage: 12:121/125 of query aligns to 4:113/130 of Q9WZC3
O34426 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Bacillus subtilis (strain 168) (see paper)
35% identity, 91% coverage: 11:124/125 of query aligns to 3:115/126 of O34426
Q9UWY8 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
38% identity, 74% coverage: 1:93/125 of query aligns to 2:92/124 of Q9UWY8
2iiiA Crystal structure of the adenosylmethionine decarboxylase (aq_254) from aquifex aeolicus vf5
38% identity, 89% coverage: 11:121/125 of query aligns to 3:112/120 of 2iiiA
Q9UWU1 Arginine decarboxylase proenzyme; ADC; ArgDC; Pyruvoyl-dependent arginine decarboxylase; EC 4.1.1.19 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 92% coverage: 1:115/125 of query aligns to 10:126/134 of Q9UWU1
>RR42_RS19905 FitnessBrowser__Cup4G11:RR42_RS19905
MNAPALPCPAVLGHHLLADLQGVASDLLADAALVERVLYRAAQAAGATVVDARFRHFGPG
LGVTGVLLLKESHISIHTWPEYGFAAVDVFMCGAARPELAVEVMRAAFVPRTLTLRDQAR
GPAPG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory