SitesBLAST
Comparing RR42_RS20290 FitnessBrowser__Cup4G11:RR42_RS20290 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oc1A Crystal structure of aryl-alcohol oxidase from pleurotus eryngii in complex with p-anisic acid (see paper)
34% identity, 94% coverage: 4:533/566 of query aligns to 2:565/565 of 5oc1A
- active site: V339 (≠ I322), N413 (= N384), A414 (vs. gap), I499 (= I467), H501 (= H469), A544 (≠ G512), H545 (≠ N513)
- binding 4-methoxybenzoic acid: Y91 (≠ G92), I356 (vs. gap), I390 (≠ P362), F396 (= F368), T412 (≠ C383), I499 (= I467), H501 (= H469), H545 (≠ N513)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), N11 (≠ S13), A12 (= A14), E32 (= E34), A33 (= A35), W60 (= W61), P78 (= P79), G80 (= G81), G85 (= G86), S86 (= S87), H90 (≠ N91), Y91 (≠ G92), V93 (≠ I94), V230 (= V219), S270 (≠ A252), A271 (= A253), G272 (= G254), F500 (= F468), H545 (≠ N513), T546 (= T514), Q547 (≠ N515), I550 (≠ T518)
3fimB Crystal structure of aryl-alcohol-oxidase from pleurotus eryingii (see paper)
33% identity, 94% coverage: 4:533/566 of query aligns to 2:565/565 of 3fimB
- active site: V339 (≠ I322), N413 (= N384), A414 (vs. gap), I499 (= I467), H501 (= H469), A544 (≠ G512), H545 (≠ N513)
- binding flavin-adenine dinucleotide: G8 (= G10), N11 (≠ S13), A12 (= A14), E32 (= E34), A33 (= A35), W60 (= W61), P78 (= P79), G80 (= G81), G85 (= G86), S86 (= S87), H90 (≠ N91), Y91 (≠ G92), V93 (≠ I94), V230 (= V219), S270 (≠ A252), A271 (= A253), F500 (= F468), H501 (= H469), H545 (≠ N513), T546 (= T514), Q547 (≠ N515), I550 (≠ T518)
5nccA Structure of fatty acid photodecarboxylase in complex with fad and palmitic acid (see paper)
35% identity, 93% coverage: 2:529/566 of query aligns to 22:569/578 of 5nccA
- active site: R347 (≠ L320), L420 (≠ V382), I421 (≠ C383), S507 (≠ I467), A509 (≠ H469), G552 (= G512), Q553 (≠ N513)
- binding flavin-adenine dinucleotide: G30 (= G10), G32 (= G12), T33 (≠ S13), A34 (= A14), L53 (= L33), E54 (= E34), A55 (= A35), F74 (≠ I54), W80 (= W61), A98 (≠ P79), G100 (= G81), G105 (= G86), S106 (= S87), N110 (= N91), A111 (≠ G92), T112 (≠ M93), L113 (≠ I94), V238 (= V219), A278 (= A253), H282 (≠ N257), L286 (= L261), N508 (≠ F468), Q553 (≠ N513), T554 (= T514), G555 (≠ N515), V558 (≠ T518)
4mjwA Crystal structure of choline oxidase in complex with the reaction product glycine betaine (see paper)
35% identity, 94% coverage: 4:533/566 of query aligns to 14:530/532 of 4mjwA
- active site: I333 (≠ L341), P377 (≠ V382), N378 (≠ C383), V464 (≠ I467), H466 (= H469), V509 (≠ G512), N510 (= N513)
- binding flavin-adenine dinucleotide: G20 (= G10), G22 (= G12), S23 (= S13), E44 (= E34), A45 (= A35), W71 (= W61), R89 (= R80), A90 (≠ G81), G95 (= G86), C96 (≠ S87), H99 (≠ I90), N100 (= N91), S101 (≠ G92), I103 (= I94), R231 (≠ Q218), A232 (≠ V219), T269 (≠ A253), G270 (= G254), D273 (≠ N257), Y465 (≠ F468), H466 (= H469), A500 (= A503), N510 (= N513), P511 (≠ T514), N512 (= N515), V515 (≠ T518)
2jbvA Crystal structure of choline oxidase reveals insights into the catalytic mechanism (see paper)
35% identity, 93% coverage: 4:530/566 of query aligns to 14:527/527 of 2jbvA
- active site: I333 (≠ L341), P377 (≠ V382), N378 (≠ C383), V464 (≠ I467), H466 (= H469), V509 (≠ G512), N510 (= N513)
- binding [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl (2R,3S,4S)-5-[(4aS,10aR)-7,8-dimethyl-2,4-dioxo-1,3,4,4a,5,10a-hexahydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl dihydrogen diphosphate: G22 (= G12), S23 (= S13), E44 (= E34), A45 (= A35), W71 (= W61), A90 (≠ G81), G95 (= G86), C96 (≠ S87), H99 (≠ I90), N100 (= N91), S101 (≠ G92), I103 (= I94), R231 (≠ Q218), A232 (≠ V219), T269 (≠ A253), G270 (= G254), D273 (≠ N257), V464 (≠ I467), Y465 (≠ F468), H466 (= H469), D499 (= D502), A500 (= A503), N510 (= N513), P511 (≠ T514), N512 (= N515), V515 (≠ T518)
A0A248QE08 Fatty acid photodecarboxylase, chloroplastic; CvFAP; EC 4.1.1.106 from Chlorella variabilis (Green alga) (see paper)
35% identity, 93% coverage: 2:529/566 of query aligns to 82:636/654 of A0A248QE08
- TA 93:94 (≠ SA 13:14) binding
- E114 (= E34) binding
- L162 (≠ V83) binding
- S166 (= S87) binding
- NATL 170:173 (≠ NGMI 91:94) binding
- V298 (= V219) binding
- C432 (≠ S339) binding
- R451 (≠ H359) binding
- Y466 (≠ H373) binding
- Q486 (≠ S381) binding
- G622 (≠ N515) binding
3ljpA Crystal structure of choline oxidase v464a mutant (see paper)
35% identity, 94% coverage: 4:533/566 of query aligns to 14:530/530 of 3ljpA
- active site: I333 (≠ L341), P377 (≠ V382), N378 (≠ C383), A464 (≠ I467), H466 (= H469), V509 (≠ G512), N510 (= N513)
- binding dihydroflavine-adenine dinucleotide: G22 (= G12), S23 (= S13), E44 (= E34), A45 (= A35), W71 (= W61), R89 (= R80), A90 (≠ G81), G95 (= G86), C96 (≠ S87), H99 (≠ I90), N100 (= N91), S101 (≠ G92), I103 (= I94), A232 (≠ V219), T269 (≠ A253), D273 (≠ N257), Y465 (≠ F468), H466 (= H469), D499 (= D502), A500 (= A503), N510 (= N513), P511 (≠ T514), N512 (= N515), V515 (≠ T518)
6yrvAAA structure of fap after illumination at 100k (see paper)
35% identity, 93% coverage: 2:529/566 of query aligns to 6:560/573 of 6yrvAAA
- binding carbon dioxide: R375 (≠ H359), N499 (≠ F468)
- binding flavin-adenine dinucleotide: G14 (= G10), G16 (= G12), T17 (≠ S13), A18 (= A14), L37 (= L33), E38 (= E34), A39 (= A35), F58 (≠ I54), W64 (= W61), A82 (≠ P79), G89 (= G86), S90 (= S87), N94 (= N91), A95 (≠ G92), T96 (≠ M93), L97 (≠ I94), M191 (≠ N188), V222 (= V219), C264 (≠ A252), A265 (= A253), G266 (= G254), H269 (≠ N257), N499 (≠ F468), A534 (= A503), Q544 (≠ N513), T545 (= T514), G546 (≠ N515)
- binding heptadecane: V377 (≠ Q361), G379 (vs. gap), M380 (≠ L363), G386 (= G369), T389 (≠ L372), Y390 (≠ H373), F393 (= F375), T408 (= T379), Q410 (≠ S381)
4ha6A Crystal structure of pyridoxine 4-oxidase - pyridoxamine complex (see paper)
38% identity, 92% coverage: 5:523/566 of query aligns to 3:498/508 of 4ha6A
- active site: F360 (≠ V382), G361 (≠ C383), H444 (≠ I467), H446 (= H469), G487 (= G512), P488 (≠ N513)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), S11 (= S13), A12 (= A14), E32 (= E34), A33 (= A35), W58 (= W61), R77 (= R80), G78 (= G81), G83 (= G86), S84 (= S87), L87 (≠ I90), H88 (≠ N91), A89 (≠ G92), M90 (= M93), G91 (≠ I94), V218 (= V219), A251 (= A253), G252 (= G254), E255 (≠ N257), H445 (≠ F468), A478 (= A503), P488 (≠ N513), I489 (≠ T514), H490 (≠ N515)
- binding 4-(aminomethyl)-5-(hydroxymethyl)-2-methylpyridin-3-ol: A89 (≠ G92), S314 (= S339), H444 (≠ I467), H446 (= H469)
3t37A Crystal structure of pyridoxine 4-oxidase from mesorbium loti
38% identity, 92% coverage: 5:523/566 of query aligns to 3:498/509 of 3t37A
- active site: F360 (≠ V382), G361 (≠ C383), H444 (≠ I467), H446 (= H469), G487 (= G512), P488 (≠ N513)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), S11 (= S13), A12 (= A14), E32 (= E34), A33 (= A35), W58 (= W61), R77 (= R80), G78 (= G81), R79 (= R82), G83 (= G86), S84 (= S87), H88 (≠ N91), A89 (≠ G92), G91 (≠ I94), R217 (≠ Q218), V218 (= V219), A251 (= A253), E255 (≠ N257), H445 (≠ F468), A478 (= A503), P488 (≠ N513), I489 (≠ T514), H490 (≠ N515)
8b7sA Crystal structure of the chloramphenicol-inactivating oxidoreductase from novosphingobium sp (see paper)
32% identity, 94% coverage: 2:534/566 of query aligns to 3:455/458 of 8b7sA
- binding flavin-adenine dinucleotide: G11 (= G10), G13 (= G12), S14 (= S13), A15 (= A14), E35 (= E34), A36 (= A35), W47 (= W61), P65 (= P79), G67 (= G81), V180 (= V219), A214 (= A253), G215 (= G254), A218 (≠ N257), T270 (≠ M336), Y391 (≠ F468), A424 (= A503), I435 (≠ T514), N436 (= N515)
8bxlB Patulin synthase from penicillium expansum (see paper)
31% identity, 92% coverage: 2:524/566 of query aligns to 12:581/590 of 8bxlB
- binding flavin-adenine dinucleotide: G20 (= G10), G22 (= G12), T23 (≠ S13), A24 (= A14), E44 (= E34), A45 (= A35), W80 (= W61), G100 (= G81), G105 (= G86), S106 (= S87), R109 (≠ I90), N110 (= N91), Y111 (≠ G92), A113 (≠ I94), L253 (≠ Q218), A254 (≠ V219), A288 (= A253), Q292 (≠ N257), F525 (= F468), D559 (= D502), A560 (= A503), H570 (≠ N513), P571 (≠ T514), Q572 (≠ N515), L575 (≠ T518)
4ynuA Crystal structure of aspergillus flavus fadgdh in complex with d- glucono-1,5-lactone (see paper)
31% identity, 94% coverage: 3:534/566 of query aligns to 3:567/569 of 4ynuA
- active site: V341 (≠ Q325), F412 (≠ V382), W413 (≠ C383), N501 (≠ I467), H503 (= H469), G545 (= G512), H546 (≠ N513)
- binding flavin-adenine dinucleotide: G12 (= G12), T13 (≠ S13), S14 (≠ A14), E34 (= E34), A35 (= A35), Y51 (= Y50), F55 (≠ I54), W61 (= W61), R79 (≠ P79), G81 (= G81), G86 (= G86), T87 (≠ S87), N91 (= N91), G92 (= G92), T232 (≠ Q218), A233 (≠ V219), A273 (= A253), G274 (= G254), R277 (≠ N257), F502 (= F468), A536 (= A503), H546 (≠ N513), L547 (≠ T514), V548 (≠ N515), L551 (≠ T518)
- binding D-glucono-1,5-lactone: Y51 (= Y50), E411 (≠ S381), A496 (≠ E462), N497 (≠ I463), R499 (≠ T465), R499 (≠ T465), N501 (≠ I467), H503 (= H469), H546 (≠ N513)
4yntA Crystal structure of aspergillus flavus fad glucose dehydrogenase (see paper)
31% identity, 94% coverage: 3:534/566 of query aligns to 4:568/570 of 4yntA
- active site: V342 (≠ Q325), F413 (≠ V382), W414 (≠ C383), N502 (≠ I467), H504 (= H469), G546 (= G512), H547 (≠ N513)
- binding dihydroflavine-adenine dinucleotide: G13 (= G12), T14 (≠ S13), S15 (≠ A14), E35 (= E34), A36 (= A35), F56 (≠ I54), W62 (= W61), R80 (≠ P79), G82 (= G81), G87 (= G86), T88 (≠ S87), N92 (= N91), G93 (= G92), M94 (= M93), A95 (≠ I94), A234 (≠ V219), A274 (= A253), R278 (≠ N257), F503 (= F468), A537 (= A503), H547 (≠ N513), L548 (≠ T514), V549 (≠ N515), L552 (≠ T518)
7vzsA Fad-dpendent glucose dehydrogenase complexed with an inhibitor at ph7.56
32% identity, 94% coverage: 3:532/566 of query aligns to 3:565/566 of 7vzsA
- binding D-glucal: Y6 (= Y6), L22 (= L22), N25 (≠ D25), Y51 (= Y50), I349 (≠ P333), Q356 (= Q340), E411 (≠ S381), E444 (≠ D414), W445 (≠ A415), K448 (= K418), R499 (≠ T465), N501 (≠ I467), H546 (≠ N513), K563 (≠ R530)
- binding flavin-adenine dinucleotide: G10 (= G10), G12 (= G12), T13 (≠ S13), S14 (≠ A14), E34 (= E34), A35 (= A35), Y51 (= Y50), F55 (≠ I54), W61 (= W61), R79 (≠ P79), G81 (= G81), G86 (= G86), T87 (≠ S87), N91 (= N91), G92 (= G92), M93 (= M93), A94 (≠ I94), T232 (≠ Q218), A233 (≠ V219), A273 (= A253), G274 (= G254), R277 (≠ N257), F502 (= F468), A536 (= A503), H546 (≠ N513), L547 (≠ T514), V548 (≠ N515), L551 (≠ T518)
Sites not aligning to the query:
E4QP00 5-(hydroxymethyl)furfural oxidase; 5-hydroxymethylfurfural oxidase; HMFO; Thiol oxidase; EC 1.1.3.47; EC 1.8.3.- from Methylovorus sp. (strain MP688) (see paper)
35% identity, 93% coverage: 4:529/566 of query aligns to 6:527/531 of E4QP00
- V101 (≠ I90) mutation to H: Abolishes activity.
- M103 (≠ G92) mutation to A: 16-fold reduction in catalytic efficiency on vanillyl alcohol.
- V367 (≠ T379) mutation to K: 1.6-fold reduction in catalytic efficiency on vanillyl alcohol. Shows significantly improved activity on the aldehyde 5-formyl-2-furancarboxylate, which results in a better 5-hydroxymethylfurfural to 2,5-furandicarboxylate conversion.; mutation to R: 1.4-fold reduction in catalytic efficiency on vanillyl alcohol. Shows significantly improved activity on the aldehyde 5-formyl-2-furancarboxylate, which results in a better 5-hydroxymethylfurfural to 2,5-furandicarboxylate conversion. Displays a catalytic efficiency toward 5-formyl-2-furancarboxylate that is over 1000-fold higher than that for wild-type; when associated with F-466.
- W369 (≠ S381) mutation to A: 7.5-fold reduction in catalytic efficiency on vanillyl alcohol.
- V465 (≠ I467) mutation to A: 18-fold reduction in catalytic efficiency on vanillyl alcohol.
- W466 (≠ F468) mutation to A: 39-fold reduction in catalytic efficiency on vanillyl alcohol. In contrast to wild-type, is active on secondary alcohols, such as (S)-1-phenylethanol, and is strictly enantionselective as this mutant has no activity on (R)-1-phenylethanol. Shows increased activity on the aldehyde 5-formyl-2-furancarboxylate.; mutation to F: 3.4-fold reduction in catalytic efficiency on vanillyl alcohol. In contrast to wild-type, is active on secondary alcohols, such as (S)-1-phenylethanol, and is strictly enantionselective as this mutant has no activity on (R)-1-phenylethanol. Shows increased activity on the aldehyde 5-formyl-2-furancarboxylate. Displays a catalytic efficiency toward 5-formyl-2-furancarboxylate that is over 1000-fold higher than that for wild-type; when associated with R-367.
- H467 (= H469) mutation to A: Abolishes activity.
- N511 (= N513) mutation to A: 53-fold reduction in catalytic efficiency on vanillyl alcohol.
4udqA Crystal structure of 5-hydroxymethylfurfural oxidase (hmfo) in the reduced state
35% identity, 93% coverage: 4:529/566 of query aligns to 2:523/525 of 4udqA
- active site: L331 (= L341), F364 (≠ A380), W365 (≠ S381), V461 (≠ I467), H463 (= H469), A506 (≠ G512), N507 (= N513)
- binding flavin-adenine dinucleotide: G8 (= G10), G10 (= G12), T11 (≠ S13), A12 (= A14), E32 (= E34), A33 (= A35), W64 (= W61), G88 (= G81), G93 (= G86), G94 (≠ S87), N98 (= N91), M99 (≠ G92), V101 (≠ I94), V229 (= V219), T261 (≠ A252), A262 (= A253), W462 (≠ F468), H463 (= H469), A497 (= A503), N507 (= N513), T508 (= T514), N509 (= N515), T512 (= T518)
Q3L245 Pyranose dehydrogenase 1; PDH 1; Pyranose:quinone oxidoreductase 1; EC 1.1.99.29 from Leucoagaricus meleagris (Western flat-topped agaric) (Agaricus meleagris) (see 2 papers)
30% identity, 93% coverage: 4:529/566 of query aligns to 41:597/602 of Q3L245
- N100 (≠ M62) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- H128 (≠ I90) modified: Tele-8alpha-FAD histidine
- N344 (= N290) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- H537 (= H469) active site, Proton acceptor
- H581 (≠ N513) active site
Sites not aligning to the query:
4h7uA Crystal structure of pyranose dehydrogenase from agaricus meleagris, wildtype (see paper)
30% identity, 93% coverage: 4:529/566 of query aligns to 16:572/577 of 4h7uA
- active site: A343 (vs. gap), V426 (≠ C383), Y510 (≠ I467), H512 (= H469), A555 (≠ G512), H556 (≠ N513)
- binding [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl (2R,3S,4S)-2,3,4-trihydroxy-5-[(4aR)-4a-hydroxy-7,8-dimethyl-2,4-dioxo-3,4,4a,5-tetrahydrobenzo[g]pteridin-10(2H)-yl]pentyl dihydrogen diphosphate (non-preferred name): G22 (= G10), G24 (= G12), T25 (≠ S13), A26 (= A14), E46 (= E34), A47 (= A35), W74 (= W61), G99 (= G86), C100 (≠ S87), H103 (≠ I90), N104 (= N91), G105 (= G92), V107 (≠ I94), L242 (≠ Q218), V243 (= V219), G282 (≠ A253), G283 (= G254), A286 (≠ N257), H512 (= H469), A546 (= A503), H556 (≠ N513), T557 (= T514), Q558 (≠ N515), V561 (≠ T518)
1cf3A Glucose oxidase from apergillus niger (see paper)
31% identity, 94% coverage: 3:532/566 of query aligns to 17:576/581 of 1cf3A
- active site: T355 (≠ R312), W424 (≠ C383), N512 (vs. gap), H514 (= H469), S556 (≠ G512), H557 (≠ N513)
- binding flavin-adenine dinucleotide: G24 (= G10), L27 (≠ S13), T28 (≠ A14), E48 (= E34), S49 (≠ A35), H76 (≠ W61), R93 (≠ P79), G95 (= G81), N96 (≠ R82), G100 (= G86), S101 (= S87), N105 (= N91), G106 (= G92), T108 (≠ I94), Y247 (≠ Q218), V248 (= V219), A287 (= A253), Y513 (≠ F468), H514 (= H469), H557 (≠ N513), V558 (≠ T514), M559 (≠ N515), F562 (≠ T518)
Query Sequence
>RR42_RS20290 FitnessBrowser__Cup4G11:RR42_RS20290
METYDYIIVGAGSAGCVLANRLTQDPEVSVLLLEAGGRDDYHWIHIPVGYLYCIGNPRTD
WMYRTVAQAGLGGRSLGYPRGRVLGGSSSINGMIYMRGQREDYDDWARLTGDDGWRWDNV
LPLFKRSEDHHRGGDEFHGAGGEWRVEGQRLRWDILERFIDAAEQAGIPRTDDFNRGDNF
GVGYFEVNQRRGIRWNTAKAFLRRAAERPNLTIVTGAQVSALTFAGRRCTGVDYLGGGKP
FTAAAREEVILAAGAVNTPQLLELSGIGQPERLQAAGIAVRHALPGVGENLQDHLQLRSV
VKVQGVRTLNTRAGSWWGKLGIGLQYAVNQSGPMSMAPSQLGAFARSDASYARPNLEYHV
QPLSLDKFGDPLHRFNAFTASVCNLRPTSRGSVHIADPDFRHAPVIAPNYLTTDADRKVA
ADSLRLTRRIVASPALAPYKPQEWLPGAAFETDEQLAQAASEIGTTIFHPVGTCRMGRPD
DPQAVVDQRLRVIGIDGLRVVDASIMPLITSGNTNSPTIMIAERASDMIREDRRRRASGV
AQGVAQGAVSPAGAEPASKAGATTQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory