SitesBLAST
Comparing RR42_RS20320 FitnessBrowser__Cup4G11:RR42_RS20320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
32% identity, 88% coverage: 34:313/319 of query aligns to 38:296/303 of 4bv9A
- active site: G58 (≠ L57), S220 (≠ F229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S82 (≠ N85), H83 (≠ I86), T111 (= T114), G134 (= G137), G136 (= G139), V137 (= V140), Q138 (= Q141), N159 (≠ S162), R160 (= R163), T161 (= T164), V195 (= V201), T196 (= T202), M197 (≠ S203), A198 (≠ S204), V217 (= V226), G218 (= G227), S283 (= S300), L284 (≠ V301), G285 (= G302)
- binding pyruvic acid: R45 (= R41), M60 (= M59), K73 (= K70), R110 (= R113)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
32% identity, 88% coverage: 34:313/319 of query aligns to 39:295/303 of 4bvaA
- active site: G59 (≠ L57), S219 (≠ F229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T110), R109 (= R113), T110 (= T114), G135 (= G139), V136 (= V140), Q137 (= Q141), N158 (≠ S162), R159 (= R163), T160 (= T164), N163 (≠ K167), V194 (= V201), T195 (= T202), M196 (≠ S203), A197 (≠ S204), V216 (= V226), S282 (= S300), L283 (≠ V301), G284 (= G302)
- binding 3,5,3'triiodothyronine: R46 (= R41), F57 (≠ T55), G59 (≠ L57), V76 (≠ I72), F78 (≠ V74), S219 (≠ F229), R220 (= R230), W223 (≠ M233), E247 (= E261)
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
31% identity, 88% coverage: 34:313/319 of query aligns to 39:304/312 of 2i99A
- active site: G59 (≠ L57), S228 (≠ F229)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: D81 (≠ Q80), S90 (vs. gap), H91 (vs. gap), R118 (= R113), T119 (= T114), G142 (= G137), A143 (= A138), G144 (= G139), V145 (= V140), Q146 (= Q141), N167 (≠ S162), R168 (= R163), T169 (= T164), V203 (= V201), T204 (= T202), L205 (≠ S203), A206 (≠ S204), V225 (= V226), G226 (= G227), S291 (= S300), L292 (≠ V301), G293 (= G302)
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
31% identity, 88% coverage: 34:313/319 of query aligns to 40:305/314 of Q14894
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
27% identity, 89% coverage: 30:314/319 of query aligns to 28:310/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ N85), T111 (= T114), G136 (= G139), V137 (= V140), Q138 (= Q141), D159 (≠ S162), I160 (≠ R163), A199 (≠ V201), T200 (= T202), T201 (≠ S203), A202 (≠ S204), V206 (= V208), V221 (= V226), G222 (= G227), W223 (≠ A228), S296 (= S300), V297 (= V301), G298 (= G302)
- binding proline: R39 (= R41), M54 (= M59), K67 (= K70), R110 (= R113)
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 68% coverage: 28:244/319 of query aligns to 35:251/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (≠ L57), K77 (= K70), R121 (= R113)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ V74), T93 (≠ N85), I94 (= I86), R121 (= R113), T122 (= T114), G147 (= G139), A148 (≠ V140), Q149 (= Q141), D170 (≠ S162), T171 (≠ R163), H175 (≠ K167), A208 (≠ V201), T209 (= T202), S210 (= S203), V211 (≠ S204), V218 (= V208), V233 (= V226), A235 (= A228)
Sites not aligning to the query:
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 68% coverage: 28:244/319 of query aligns to 35:251/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ V74), T93 (≠ N85), I94 (= I86), T122 (= T114), G147 (= G139), A148 (≠ V140), Q149 (= Q141), D170 (≠ S162), T171 (≠ R163), A208 (≠ V201), T209 (= T202), S210 (= S203), V211 (≠ S204), V233 (= V226), A235 (= A228)
- binding proline: M65 (= M59), K77 (= K70), R121 (= R113)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
35% identity, 68% coverage: 28:244/319 of query aligns to 39:255/357 of 5gzlA
- binding lysine: G55 (≠ A43), E57 (≠ P45), I65 (≠ T55), E67 (≠ L57), D240 (≠ F229)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ V74), T97 (≠ N85), I98 (= I86), T126 (= T114), G151 (= G139), A152 (≠ V140), Q153 (= Q141), D174 (≠ S162), T175 (≠ R163), H179 (≠ K167), A212 (≠ V201), T213 (= T202), S214 (= S203), V222 (= V208), V237 (= V226), G238 (= G227), A239 (= A228), D240 (≠ F229), K244 (≠ M233)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
35% identity, 68% coverage: 28:244/319 of query aligns to 39:255/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ V74), T97 (≠ N85), R125 (= R113), T126 (= T114), G151 (= G139), A152 (≠ V140), Q153 (= Q141), D174 (≠ S162), T175 (≠ R163), H179 (≠ K167), A212 (≠ V201), T213 (= T202), S214 (= S203), V215 (≠ S204), V237 (= V226), G238 (= G227), A239 (= A228)
- binding (2S)-piperidine-2-carboxylic acid: R53 (= R41), K81 (= K70), R125 (= R113), A239 (= A228)
Sites not aligning to the query:
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
28% identity, 70% coverage: 34:255/319 of query aligns to 34:241/320 of 1omoA
- active site: R52 (≠ L57), D219 (≠ F229)
- binding nicotinamide-adenine-dinucleotide: T109 (= T114), G134 (= G139), T135 (≠ V140), Q136 (= Q141), Y156 (≠ H161), D157 (≠ S162), V158 (≠ R163), R159 (≠ T164), T195 (= T202), P196 (≠ S203), G217 (= G227), D219 (≠ F229), K223 (≠ M233)
Sites not aligning to the query:
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
28% identity, 70% coverage: 34:255/319 of query aligns to 34:241/322 of O28608
Sites not aligning to the query:
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 75% coverage: 70:308/319 of query aligns to 71:311/325 of Q9FLY0
- G89 (= G88) mutation to E: In sard4-3; compromises systemic acquired resistance (SAR).
- G138 (= G137) mutation to D: In sard4-4; compromises systemic acquired resistance (SAR).
- S205 (≠ V199) mutation to N: In sard4-1; compromises systemic acquired resistance (SAR).
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
26% identity, 80% coverage: 54:308/319 of query aligns to 52:300/341 of 1u7hA
- active site: E55 (≠ L57), D227 (≠ F229)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ N85), R111 (= R113), T112 (= T114), G137 (= G139), A138 (≠ V140), Q139 (= Q141), D160 (≠ S162), T161 (≠ R163), V200 (= V201), T201 (= T202), A202 (≠ S203), I209 (≠ P207), V224 (= V226), G225 (= G227), D227 (≠ F229), K231 (≠ M233), S292 (= S300), V293 (= V301), G294 (= G302)
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
26% identity, 80% coverage: 54:308/319 of query aligns to 52:300/340 of 1x7dA
- active site: E55 (≠ L57), D227 (≠ F229)
- binding nicotinamide-adenine-dinucleotide: T83 (≠ N85), R111 (= R113), T112 (= T114), G137 (= G139), A138 (≠ V140), Q139 (= Q141), D160 (≠ S162), T161 (≠ R163), V200 (= V201), T201 (= T202), A202 (≠ S203), I209 (≠ P207), V224 (= V226), G225 (= G227), D227 (≠ F229), K231 (≠ M233), S292 (= S300), V293 (= V301), G294 (= G302)
- binding L-ornithine: V53 (≠ T55), E55 (≠ L57), M57 (= M59), K68 (= K70), V70 (≠ I72), N71 (≠ T73), G72 (≠ V74), R111 (= R113), D227 (≠ F229), V293 (= V301)
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
26% identity, 80% coverage: 54:308/319 of query aligns to 53:301/350 of Q88H32
Sites not aligning to the query:
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
31% identity, 56% coverage: 76:255/319 of query aligns to 73:244/320 of A1B8Z0
Sites not aligning to the query:
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 56% coverage: 76:255/319 of query aligns to 75:246/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ G77)
- binding nicotinamide-adenine-dinucleotide: T113 (= T114), G138 (= G139), Q140 (= Q141), P162 (≠ R163), H163 (≠ T164), I199 (≠ V201), T200 (= T202), S201 (= S203), S202 (= S204), M221 (≠ V226), G222 (= G227), D224 (≠ F229), K228 (≠ M233)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 56% coverage: 76:255/319 of query aligns to 75:246/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ I86), T113 (= T114), G138 (= G139), H139 (≠ V140), Q140 (= Q141), N161 (≠ S162), P162 (≠ R163), H163 (≠ T164), M166 (≠ K167), I199 (≠ V201), T200 (= T202), S201 (= S203), S202 (= S204), M221 (≠ V226), G222 (= G227), D224 (≠ F229), K228 (≠ M233)
Sites not aligning to the query:
Query Sequence
>RR42_RS20320 FitnessBrowser__Cup4G11:RR42_RS20320
MSVALLDAAQTAARLPYPALARAIAAMLAELRAGTAMAPPRIALPVGDPAGGEGTLLVMP
ARNRELVMTKNITVHPGNPQRGLPNILGEVVVADAHTGRRLALLDGPTVTGRRTAAVSLL
AAQSFAPDPAGELLIIGAGVQALTHLEAFAAGLSPRRVWLHSRTAAKAEALAAHARTLGV
EAQSVDDVRTVLPRVSMVVTVTSSLVPVLPDLDSGLWRDDHFIAAVGAFRPEMCELPPAL
CQAASAHGRLLADTLFGIEEEAGDLLQAGIAWSTVQPFERAILAEDALRARGGSPLVFKS
VGYALWDLAACVLASAGTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory