Comparing RR42_RS20415 RR42_RS20415 ABC transporter substrate-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
59% identity, 86% coverage: 46:371/377 of query aligns to 2:327/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
59% identity, 86% coverage: 48:371/377 of query aligns to 32:355/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
55% identity, 88% coverage: 44:373/377 of query aligns to 1:330/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
47% identity, 87% coverage: 46:372/377 of query aligns to 3:329/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
41% identity, 85% coverage: 50:368/377 of query aligns to 5:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 85% coverage: 50:368/377 of query aligns to 6:325/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
26% identity, 81% coverage: 32:336/377 of query aligns to 18:336/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
27% identity, 71% coverage: 70:336/377 of query aligns to 24:305/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
27% identity, 71% coverage: 70:336/377 of query aligns to 24:305/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
28% identity, 50% coverage: 68:254/377 of query aligns to 20:207/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
30% identity, 42% coverage: 70:227/377 of query aligns to 24:182/563 of 7e9yA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
24% identity, 67% coverage: 46:296/377 of query aligns to 1:248/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 66% coverage: 48:296/377 of query aligns to 2:247/315 of 4uabA
6wgmA Crystal structure of a marine metagenome trap solute binding protein specific for pyroglutamate (sorcerer ii global ocean sampling expedition, unidentified microbe, scf7180008839099) in complex with co-purified pyroglutamate
25% identity, 66% coverage: 69:315/377 of query aligns to 24:265/304 of 6wgmA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
26% identity, 54% coverage: 48:249/377 of query aligns to 4:204/304 of 4x8rA
Sites not aligning to the query:
4nhbB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio desulfuricans (ddes_1525), target efi-510107, with bound sn-glycerol-3-phosphate (see paper)
22% identity, 78% coverage: 66:358/377 of query aligns to 18:307/311 of 4nhbB
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
22% identity, 76% coverage: 66:351/377 of query aligns to 20:296/314 of 4p8bA
Sites not aligning to the query:
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
24% identity, 49% coverage: 64:248/377 of query aligns to 19:204/308 of 4mmpA
Sites not aligning to the query:
2pfyA Crystal structure of dctp7, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
24% identity, 48% coverage: 47:228/377 of query aligns to 1:179/301 of 2pfyA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
25% identity, 52% coverage: 55:249/377 of query aligns to 38:226/328 of Q0B2F6
Sites not aligning to the query:
>RR42_RS20415 RR42_RS20415 ABC transporter substrate-binding protein
MERRSFLLKASAVAATGALAACGKEEKAAAPAAAGASAPAVIGSNPAVEWRLASSFPKSL
DTIYGGAELLSQRVKELTDGKFNIKVFAAGELVPGLQVLDSVQNNTVQIGHTAGYYYFGK
NPTLCFDTTVPFGLTSRQQNAWMMQGNGMKLMREFFKEYNVVNFLGGNTNAQMGGWFRKE
IKTVADLQGLKYRIAGFAGVVLSRLGVVPQQIAGGDIYPALEKGTIDAAEWVGPYDDEKL
GFYKVAPYYYYPGWWEGSAQLSFYSSATEYEKLPALYKRALETATIEVHTNMMAKYDTVN
PQALARLLENGVKLRPFSKEIMEACFKATQDAYAEETAKNPSFKKIYDDWRVFRNNEAAW
FNVAEQAFSQFSFSRKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory