Comparing RR42_RS20620 FitnessBrowser__Cup4G11:RR42_RS20620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
29% identity, 82% coverage: 56:308/310 of query aligns to 39:293/302 of 8hkbA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 70% coverage: 80:295/310 of query aligns to 68:284/300 of 2dvzA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
25% identity, 93% coverage: 21:308/310 of query aligns to 5:293/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
25% identity, 93% coverage: 21:308/310 of query aligns to 5:293/294 of 7ndsA
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
25% identity, 71% coverage: 42:261/310 of query aligns to 22:247/296 of 6hkeB
Sites not aligning to the query:
5okuA R. Palustris rpa4515 with adipate (see paper)
25% identity, 73% coverage: 21:246/310 of query aligns to 7:233/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
25% identity, 73% coverage: 21:246/310 of query aligns to 7:233/299 of 5oeiA
2f5xB Structure of periplasmic binding protein bugd (see paper)
26% identity, 52% coverage: 106:265/310 of query aligns to 92:248/300 of 2f5xB
Sites not aligning to the query:
>RR42_RS20620 FitnessBrowser__Cup4G11:RR42_RS20620
MASAAITATVAAAPAFALDSVKFMIGANPGGGFDQTGRSLGAALVSAGVAKTASYDNKGG
AGGTIGLTQFVNTDKGNPNAMIVTGAVMVGAIETNHPPVTLKNATPIARLFADTMVITVP
ANSPLKSMKDLTAQLRANPGSVSWGGGSKGSIDHILAGLVAKESGVDPKKINYVPFQGGG
EASASILGGHVTVGLAGVSEFLPFIKSGKMRALAVTSKDRTADIPTLKEQGINVEIYNWR
GVYGAPGITAEQRKALVDAVVKATETPLWKETLAKNDWTPFLLTGDEFGKFVDSESARLG
GSLRELGVAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory