SitesBLAST
Comparing RR42_RS21135 FitnessBrowser__Cup4G11:RR42_RS21135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
41% identity, 96% coverage: 6:250/255 of query aligns to 12:256/261 of 5u9pB
- active site: G27 (= G21), S152 (= S146), Y165 (= Y159), K169 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G17), R26 (≠ Q20), G27 (= G21), I28 (≠ L22), R48 (= R42), D73 (= D67), V74 (= V68), N100 (= N94), A101 (= A95), I150 (≠ V144), Y165 (= Y159), K169 (= K163), P195 (= P189), F198 (= F192), T200 (= T194), L202 (≠ P196), N203 (= N197)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
39% identity, 98% coverage: 6:254/255 of query aligns to 2:252/252 of 1vl8B
- active site: G17 (= G21), S143 (= S146), I154 (≠ D156), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G17), R16 (≠ Q20), G17 (= G21), L18 (= L22), S37 (≠ A41), R38 (= R42), C63 (≠ L66), D64 (= D67), V65 (= V68), A91 (≠ N94), A92 (= A95), G93 (= G96), I94 (≠ A97), V114 (≠ T117), I141 (≠ V144), S143 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), G188 (= G190), Y190 (≠ F192), T192 (= T194), M194 (≠ P196), T195 (≠ N197)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
39% identity, 98% coverage: 6:254/255 of query aligns to 7:249/254 of 3o03A
- active site: G22 (= G21), S147 (= S146), V157 (≠ D156), Y160 (= Y159), K164 (= K163)
- binding calcium ion: S147 (= S146), M148 (≠ I147), P190 (= P189)
- binding D-gluconic acid: I99 (≠ R98), R101 (= R100), S147 (= S146), M149 (≠ A148), R154 (= R153), Y160 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G17), Y21 (≠ Q20), G22 (= G21), I23 (≠ L22), D42 (≠ A41), I43 (≠ R42), L47 (≠ R46), D68 (= D67), V69 (= V68), N95 (= N94), A96 (= A95), G97 (= G96), I145 (≠ V144), Y160 (= Y159), K164 (= K163), P190 (= P189)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
43% identity, 98% coverage: 5:254/255 of query aligns to 3:246/246 of 4hp8B
- active site: G19 (= G21), S138 (= S146), V148 (≠ D156), Y151 (= Y159), K155 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), N17 (≠ A19), T18 (≠ Q20), G19 (= G21), L20 (= L22), R40 (= R42), R41 (≠ N43), D63 (= D67), F64 (≠ V68), N85 (= N94), G87 (= G96), I88 (≠ A97), I136 (≠ V144), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (≠ F192), T186 (= T194), N188 (≠ P196), T189 (≠ N197)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
39% identity, 96% coverage: 6:250/255 of query aligns to 4:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), S17 (≠ A19), R18 (≠ Q20), I20 (≠ L22), T40 (≠ N43), N62 (≠ D67), V63 (= V68), N89 (= N94), A90 (= A95), I92 (≠ A97), V139 (= V144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (≠ F192), T189 (= T194), M191 (≠ P196)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 96% coverage: 6:250/255 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G21), S138 (= S146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), T37 (≠ R42), L58 (= L66), N59 (≠ D67), V60 (= V68), A87 (= A95), G88 (= G96), I89 (≠ A97)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
37% identity, 96% coverage: 9:253/255 of query aligns to 4:244/244 of 6wprA
- active site: G16 (= G21), S138 (= S146), Y151 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), T37 (≠ R42), L58 (= L66), D59 (= D67), V60 (= V68), N86 (= N94), A87 (= A95), G88 (= G96), I89 (≠ A97), I136 (≠ V144), Y151 (= Y159), K155 (= K163), P181 (= P189)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
40% identity, 96% coverage: 6:250/255 of query aligns to 8:250/254 of 4ag3A
- active site: G23 (= G21), S148 (= S146), Y161 (= Y159), K165 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G17), S21 (≠ A19), R22 (≠ Q20), G23 (= G21), I24 (≠ L22), T44 (≠ R42), L68 (= L66), D69 (= D67), V70 (= V68), N96 (= N94), A97 (= A95), I146 (≠ V144), S148 (= S146), Y161 (= Y159), K165 (= K163), P191 (= P189), G192 (= G190), F193 (≠ Y191), I194 (≠ F192), T196 (= T194), M198 (≠ P196), T199 (≠ N197)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
37% identity, 96% coverage: 9:253/255 of query aligns to 4:244/244 of 6t62A
- active site: G16 (= G21), S138 (= S146), Y151 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), A36 (= A41), T37 (≠ R42), L58 (= L66), D59 (= D67), V60 (= V68), N86 (= N94), A87 (= A95), G88 (= G96), I89 (≠ A97), I136 (≠ V144), S137 (= S145), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), I184 (≠ F192), M188 (≠ P196)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
39% identity, 96% coverage: 6:250/255 of query aligns to 4:239/243 of 4i08A
- active site: G19 (= G21), N113 (= N118), S141 (= S146), Q151 (≠ D156), Y154 (= Y159), K158 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G17), S17 (≠ A19), R18 (≠ Q20), I20 (≠ L22), T40 (≠ N43), N62 (≠ D67), V63 (= V68), N89 (= N94), A90 (= A95), G140 (≠ S145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), T189 (= T194)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
43% identity, 98% coverage: 5:253/255 of query aligns to 2:248/249 of 3uf0A
- active site: G18 (= G21), S141 (= S146), V151 (≠ D156), Y154 (= Y159), K158 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G17), S17 (≠ Q20), G18 (= G21), I19 (≠ L22), R39 (= R42), D63 (= D67), L64 (≠ V68), N89 (= N94), G91 (= G96), I92 (≠ A97), I139 (≠ V144), A140 (≠ S145), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), V187 (≠ F192), T189 (= T194), N191 (≠ P196), T192 (≠ N197)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 96% coverage: 6:250/255 of query aligns to 1:240/244 of P0AEK2
- GASR 12:15 (≠ GGAQ 17:20) binding
- T37 (≠ R42) binding
- NV 59:60 (≠ DV 67:68) binding
- N86 (= N94) binding
- Y151 (= Y159) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YPATK 159:163) binding
- A154 (≠ T162) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K163) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ F192) binding
- E233 (≠ H243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 96% coverage: 6:250/255 of query aligns to 1:240/244 of P0A2C9
- M125 (= M133) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A233) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S234) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
38% identity, 96% coverage: 7:250/255 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G21), E101 (≠ D110), S137 (= S146), Q147 (≠ D156), Y150 (= Y159), K154 (= K163)
- binding calcium ion: E232 (≠ H243), T233 (≠ V244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G17), S13 (≠ A19), R14 (≠ Q20), T36 (≠ R42), N58 (≠ D67), V59 (= V68), N85 (= N94), A86 (= A95), G87 (= G96), I88 (≠ A97), S137 (= S146), Y150 (= Y159), K154 (= K163), P180 (= P189), G181 (= G190), I183 (≠ F192)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
38% identity, 96% coverage: 7:250/255 of query aligns to 1:239/243 of 1q7cA
- active site: G15 (= G21), S137 (= S146), Q147 (≠ D156), F150 (≠ Y159), K154 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G17), S13 (≠ A19), R14 (≠ Q20), A35 (= A41), T36 (≠ R42), L57 (= L66), N58 (≠ D67), V59 (= V68), G87 (= G96), I88 (≠ A97)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
37% identity, 96% coverage: 7:250/255 of query aligns to 1:239/243 of 7emgB
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 97% coverage: 6:252/255 of query aligns to 1:246/247 of 4jroC
- active site: G16 (= G21), S142 (= S146), Q152 (≠ D156), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G17), S14 (≠ A19), R15 (≠ Q20), G16 (= G21), I17 (≠ L22), N35 (≠ A40), Y36 (≠ A41), N37 (≠ R42), G38 (≠ N43), S39 (≠ A44), N63 (≠ D67), V64 (= V68), N90 (= N94), A91 (= A95), I93 (≠ A97), I113 (≠ T117), S142 (= S146), Y155 (= Y159), K159 (= K163), P185 (= P189), I188 (≠ F192), T190 (= T194)
4bnzA Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-methyl-n-phenylindole- 3-carboxamide at 2.5a resolution (see paper)
40% identity, 96% coverage: 6:250/255 of query aligns to 3:237/241 of 4bnzA
4bo2A Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with 1-(1-ethylbenzimidazol-2- yl)-3-(2-methoxyphenyl)urea at 1.9a resolution (see paper)
40% identity, 96% coverage: 6:250/255 of query aligns to 5:234/238 of 4bo2A
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
40% identity, 96% coverage: 5:250/255 of query aligns to 13:251/255 of 4bo4C
Query Sequence
>RR42_RS21135 FitnessBrowser__Cup4G11:RR42_RS21135
MATLPFSLEGRVALVTGGAQGLGQAIAAGLAQAGAHVIVAARNAERVHAAVAALAADGGR
AEPLVLDVTDAAAVDAAFAHIDATHGRLDILVNNAGARNRSNMAHLNAADLREMLETNLV
APYALCRHAAQLMRRGRYGRIVNVSSIAGQVARANDVLYPATKGGLDALTRAMAADLGRD
GVTVNAVAPGYFATEPNQPMVDDAGVAEWLRQRTALGRWGQPEEIAGAVVFLASGAASYV
TGHVLAVDGGYLAHF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory