Comparing RR42_RS21205 FitnessBrowser__Cup4G11:RR42_RS21205 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WQB3 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
51% identity, 96% coverage: 5:549/565 of query aligns to 42:641/644 of P9WQB3
Sites not aligning to the query:
3hpzB Crystal structure of mycobacterium tuberculosis leua complexed with bromopyruvate
54% identity, 96% coverage: 5:549/565 of query aligns to 25:574/576 of 3hpzB
3figB Crystal structure of leucine-bound leua from mycobacterium tuberculosis (see paper)
54% identity, 96% coverage: 5:549/565 of query aligns to 25:574/577 of 3figB
3hq1A Crystal structure of mycobacterium tuberculosis leua complexed with citrate and mn2+
54% identity, 96% coverage: 5:549/565 of query aligns to 25:571/573 of 3hq1A
1sr9A Crystal structure of leua from mycobacterium tuberculosis (see paper)
54% identity, 96% coverage: 5:549/565 of query aligns to 25:571/573 of 1sr9A
3hpsA Crystal structure of mycobacterium tuberculosis leua complexed with ketoisocaproate (kic)
53% identity, 96% coverage: 5:549/565 of query aligns to 25:573/575 of 3hpsA
4ov4A Isopropylmalate synthase binding with ketoisovalerate (see paper)
28% identity, 69% coverage: 38:429/565 of query aligns to 11:377/379 of 4ov4A
4ov9A Structure of isopropylmalate synthase binding with alpha- isopropylmalate (see paper)
28% identity, 69% coverage: 38:429/565 of query aligns to 11:379/380 of 4ov9A
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 94% coverage: 28:556/565 of query aligns to 4:509/517 of Q9JZG1
Sites not aligning to the query:
Q9FN52 Methylthioalkylmalate synthase 3, chloroplastic; 2-isopropylmalate synthase 2; Methylthioalkylmalate synthase-like; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 66% coverage: 22:393/565 of query aligns to 79:439/503 of Q9FN52
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
27% identity, 70% coverage: 36:429/565 of query aligns to 23:406/409 of 6e1jA
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
29% identity, 53% coverage: 32:332/565 of query aligns to 5:293/308 of 3rmjB
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 62% coverage: 36:383/565 of query aligns to 90:429/506 of Q9FG67
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
24% identity, 62% coverage: 34:383/565 of query aligns to 25:343/399 of 6ktqA
2zyfA Crystal structure of homocitrate synthase from thermus thermophilus complexed with magnesuim ion and alpha-ketoglutarate (see paper)
26% identity, 55% coverage: 33:342/565 of query aligns to 4:290/314 of 2zyfA
2ztjA Crystal structure of homocitrate synthase from thermus thermophilus complexed with alpha-ketoglutarate (see paper)
26% identity, 55% coverage: 33:342/565 of query aligns to 4:288/312 of 2ztjA
3a9iA Crystal structure of homocitrate synthase from thermus thermophilus complexed with lys (see paper)
25% identity, 55% coverage: 34:342/565 of query aligns to 6:289/347 of 3a9iA
O87198 Homocitrate synthase; HCS; EC 2.3.3.14 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
26% identity, 55% coverage: 33:342/565 of query aligns to 4:296/376 of O87198
Q8F3Q1 (R)-citramalate synthase CimA; LiCMS; EC 2.3.3.21 from Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) (see 2 papers)
23% identity, 51% coverage: 210:499/565 of query aligns to 176:454/516 of Q8F3Q1
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 56% coverage: 26:342/565 of query aligns to 26:320/400 of 3ivtB
>RR42_RS21205 FitnessBrowser__Cup4G11:RR42_RS21205
MLRNPATKYRPATAVDIADRTWPAKRITRAPVWMSTDLRDGNQALIEPMNPQRKLRFFEQ
LVKIGLKQIEVAFPSASQTDFDFVRMLIEEDRIPDDVTIVVLTQAREDLIRRTIESVRGA
ARAVVHLYNPIAPAFRRIVFGASREEVKEIALEGTRLIKALTDGMPETAWSYEYSPETFS
MTELDFSLEVCDAVSAIWQPGPTRPLILNLPTTVECSTPNIFADQVEWMHRHLARRADIV
LSVHPHNDRGTAVAAAELAVMAGADRVEGCLFGNGERTGNVDLVTLALNLYTQGVDPGLD
FSDIDEVRQCVEDCNQLPVHPRHPYVGDLVFTAFSGSHQDAIRKGFAQHKADAIWEVPYL
PIDPADLGRSYDAVIRVNSQSGKGGMAYLLEQVHGIYMPRRLQIEFSRAVQSMTDESGLE
ASADDLYGLFKREYLEHEAPLRYMGHQMVSGSDGQVEIEVALLRDGEALSARGRGNGPID
AFVSGLNGALDMPVRVMDYHEHALSCGANAAAACYVEVRVGDSATGFGAGIDASIVTASL
KAVVSGVNRHLLAASPSQREDALVD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory