SitesBLAST
Comparing RR42_RS21430 FitnessBrowser__Cup4G11:RR42_RS21430 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
21% identity, 76% coverage: 53:384/436 of query aligns to 32:381/446 of A0A0H2VG78
- R102 (= R132) mutation to A: Loss of transport activity.
- I105 (≠ Q135) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E152) mutation to A: Loss of transport activity.
- Q137 (≠ Y167) mutation to A: Loss of transport activity.
- Q250 (= Q269) mutation to A: Loss of transport activity.
- Q251 (≠ K270) mutation to A: Loss of transport activity.
- N256 (= N274) mutation to A: Loss of transport activity.
- W357 (≠ G360) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 36% coverage: 89:245/436 of query aligns to 93:234/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
24% identity, 78% coverage: 85:426/436 of query aligns to 78:437/452 of Q5EXK5
- D82 (= D89) mutation to A: Loss of activity.
- V311 (≠ A303) mutation to W: Loss of activity.
- D314 (= D306) mutation to A: Loss of activity.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 47% coverage: 19:222/436 of query aligns to 36:248/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
27% identity, 38% coverage: 79:245/436 of query aligns to 66:245/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
27% identity, 38% coverage: 79:245/436 of query aligns to 66:245/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
27% identity, 38% coverage: 79:245/436 of query aligns to 66:245/475 of 4gbyA
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
27% identity, 38% coverage: 79:245/436 of query aligns to 70:249/491 of P0AGF4
- G83 (= G92) mutation to A: Abolishes xylose transport.
- R133 (= R132) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E152) mutation to A: Abolishes xylose transport.
- R160 (= R159) mutation to A: Abolishes xylose transport.
- Q168 (≠ Y167) binding ; mutation to A: Abolishes xylose transport.
Sites not aligning to the query:
- 24 F→A: Decreases xylose transport.
- 288 Q→A: Abolishes xylose transport.
- 288:289 binding
- 289 Q→A: Strongly decreases xylose transport.
- 294 binding ; N→A: Abolishes xylose transport.
- 298 Y→A: Abolishes xylose transport.
- 325 N→A: No effect on xylose transport.
- 340 G→A: Abolishes xylose transport.
- 341 mutation R->A,W: Abolishes xylose transport.
- 392 binding ; W→A: Abolishes xylose transport.
- 397 E→A: Abolishes xylose transport.
- 404 R→A: Strongly decreases xylose transport.
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
31% identity, 31% coverage: 79:213/436 of query aligns to 92:213/444 of Q8NLB7
- R103 (= R90) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 36% coverage: 87:245/436 of query aligns to 90:233/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
29% identity, 72% coverage: 69:384/436 of query aligns to 55:349/403 of P77589
- D75 (= D89) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (= A303) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R307) mutation to D: Lack of 3HPP transport activity.
Sites not aligning to the query:
- 27 E→A: Lack of 3HPP transport activity.; E→D: Slight decrease in 3HPP transport activity.
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 33% coverage: 87:232/436 of query aligns to 105:236/514 of Q9LT15
- E162 (= E152) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q166) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ V178) mutation to A: Reduces affinity for glucose 3-fold.
Sites not aligning to the query:
- 39 F→A: Reduces affinity for glucose 8-fold.
- 43 L→A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- 77 modified: Disulfide link with 449; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- 295 binding
- 296 binding
- 301 binding
- 332 binding
- 344 D→N: Abolishes glucose transport activity; when associated with Q-162.
- 410 binding
- 449 modified: Disulfide link with 77; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
28% identity, 36% coverage: 87:241/436 of query aligns to 85:227/487 of 7aaqA
Sites not aligning to the query:
Query Sequence
>RR42_RS21430 FitnessBrowser__Cup4G11:RR42_RS21430
MTDLSAPLLDAPPSAEEKRKRVYAIVAASSGNLVEWFDFYVYAFCAIYFAGSFFPKSDPT
AQLLNTAGVFAAGFLMRPIGGWLFGRIADRHGRKNSLLISVTMMCCGSLLIASLPTYNSI
GAWAPALLLVARLLQGLSVGGEYGTTATYMSEVALKGQRGFFSSFQYVTLIGGQLLAVLV
VVVLQQFLDEAELKAWGWRIPFVIGAITAVVALFLRRTLHETTSAATRASKEAGTLTELF
RNHKAAFFTVLGYTAGGSLIFYTFTTYMQKYLVNSAGMSIKTASYVMTGCLFFYMCMQPF
FGALSDRIGRRTNMLLFGALGTLATVPILTALGSVKSPFVAFALISLALAIVSLYTSISG
IVKAEMFPTEIRALGVGLAYAVANAIFGGSAEYVALDLKSLGHESSFYWYVTAMMVIVFL
VSFRLPRQARYLHHEH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory