SitesBLAST
Comparing RR42_RS21725 FitnessBrowser__Cup4G11:RR42_RS21725 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35486 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Mus musculus (Mouse) (see 2 papers)
38% identity, 96% coverage: 12:333/334 of query aligns to 53:371/390 of P35486
- S232 (≠ A193) modified: Phosphoserine; by PDK1
- S293 (≠ F256) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- S300 (≠ T262) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- K336 (= K298) modified: N6-acetyllysine; mutation K->Q,R: Decreases phosphorylation at S-232 and S-300 but does not affect activity or substrate metabolism.
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
38% identity, 96% coverage: 12:333/334 of query aligns to 53:371/390 of P26284
- S232 (≠ A193) modified: Phosphoserine; by PDK1
- S293 (≠ F256) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
- S300 (≠ T262) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4
P29803 Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; EC 1.2.4.1 from Homo sapiens (Human) (see 4 papers)
37% identity, 96% coverage: 12:333/334 of query aligns to 51:369/388 of P29803
- M227 (≠ E190) to V: in SPGF70; uncertain significance; dbSNP:rs200969445
- S230 (≠ A193) mutation to A: Slightly reduces enzyme activity.
- S291 (≠ F256) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Strongly reduces enzyme activity. Increases enzyme activity in stem cells.; mutation S->E,D: Abolishes enzyme activity. Increases neuronal cell death in response to glutamate excitotoxicity.
- S293 (≠ G258) modified: Phosphoserine; mutation to A: Increases enzyme activity in stem cells.; mutation to D: Abolishes enzyme activity. Increases neuronal cell death in response to glutamate excitotoxicity.
- S298 (≠ T262) modified: Phosphoserine; by PDK3; mutation to A: Slightly reduces enzyme activity.
P26267 Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial; PDHA1; PDHE1-A; EC 1.2.4.1 from Ascaris suum (Pig roundworm) (Ascaris lumbricoides) (see paper)
38% identity, 95% coverage: 15:331/334 of query aligns to 52:365/396 of P26267
- S289 (≠ F256) modified: Phosphoserine
- S296 (vs. gap) modified: Phosphoserine
Q10489 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; PDHE1-A; EC 1.2.4.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 96% coverage: 13:333/334 of query aligns to 71:390/409 of Q10489
- Y306 (≠ F252) modified: Phosphotyrosine
- S310 (≠ F256) modified: Phosphoserine
- S312 (≠ G258) modified: Phosphoserine
Sites not aligning to the query:
- 6 modified: Phosphothreonine
P16387 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; Pyruvate dehydrogenase complex component E1 alpha; PDHE1-A; EC 1.2.4.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
37% identity, 95% coverage: 17:332/334 of query aligns to 78:392/420 of P16387
- S313 (≠ F256) modified: Phosphoserine; by PDK1 and PDK2
Sites not aligning to the query:
- 1:33 modified: transit peptide, Mitochondrion
Q8H1Y0 Pyruvate dehydrogenase E1 component subunit alpha-2, mitochondrial; PDHE1-A; Protein IAA-CONJUGATE-RESISTANT 4; EC 1.2.4.1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 99% coverage: 1:332/334 of query aligns to 44:373/393 of Q8H1Y0
- R121 (= R78) mutation to C: In iar4-1; reduced sensitivity to several IAA-amino acid conjugates.
P08559 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Homo sapiens (Human) (see 13 papers)
38% identity, 96% coverage: 12:333/334 of query aligns to 53:371/390 of P08559
- A136 (≠ K95) to T: found in a patient with moderate developmental delay, mild dysmorphism and mildly elevated serum lactate; uncertain significance; dbSNP:rs138727886
- S232 (≠ A193) modified: Phosphoserine; by PDK1; mutation to A: Abolishes inactivation by phosphorylation; when associated with A-293 and A-300.
- M282 (≠ L245) to L: in dbSNP:rs2229137
- S293 (≠ F256) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Reduces enzyme activity. Abolishes inactivation by phosphorylation; when associated with A-232 and A-300.; mutation to E: Interferes with substrate binding.
- S300 (≠ T262) modified: Phosphoserine; by PDK1, PDK2, PDK3 and PDK4; mutation to A: Abolishes inactivation by phosphorylation; when associated with A-232 and A-293.
- R302 (= R264) to C: in PDHAD; loss of activity; common mutation; dbSNP:rs137853252
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
- 10 R → P: in PDHAD; affects mitochondrial import of precursor protein; dbSNP:rs137853257
6cfoA Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
38% identity, 96% coverage: 12:333/334 of query aligns to 25:343/362 of 6cfoA
- active site: Q52 (≠ V39), G137 (= G126), R260 (= R251), H264 (= H255), S265 (≠ F256), Y273 (= Y263)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1S)-1-hydroxy-1-[(R)-hydroxy(oxo)-lambda~5~-phosphanyl]ethyl}-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: F62 (= F49), Y90 (≠ H77), R91 (= R78), G137 (= G126), V139 (≠ L128), G167 (= G156), D168 (= D157), G169 (= G158), N197 (= N186), Y199 (= Y188), G200 (≠ A189), H264 (= H255)
- binding magnesium ion: D168 (= D157), N197 (= N186), Y199 (= Y188)
1ni4A Human pyruvate dehydrogenase (see paper)
38% identity, 96% coverage: 12:333/334 of query aligns to 25:343/362 of 1ni4A
- active site: Q52 (≠ V39), G137 (= G126), R260 (= R251), H264 (= H255), S265 (≠ F256), Y273 (= Y263)
- binding magnesium ion: D168 (= D157), N197 (= N186), Y199 (= Y188)
- binding thiamine diphosphate: Y90 (≠ H77), R91 (= R78), V139 (≠ L128), G167 (= G156), D168 (= D157), G169 (= G158), A170 (= A159), N197 (= N186), G200 (≠ A189), H264 (= H255)
3exeA Crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex (see paper)
38% identity, 96% coverage: 12:333/334 of query aligns to 26:344/363 of 3exeA
- active site: Q53 (≠ V39), G138 (= G126), R261 (= R251), H265 (= H255), S266 (≠ F256), Y274 (= Y263)
- binding manganese (ii) ion: D169 (= D157), N198 (= N186), Y200 (= Y188)
- binding thiamine diphosphate: Y91 (≠ H77), R92 (= R78), V140 (≠ L128), G168 (= G156), D169 (= D157), G170 (= G158), A171 (= A159), N198 (= N186), Y200 (= Y188), G201 (≠ A189), H265 (= H255)
6cerE Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
37% identity, 96% coverage: 12:333/334 of query aligns to 25:321/340 of 6cerE
6cerA Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
37% identity, 96% coverage: 12:333/334 of query aligns to 26:323/342 of 6cerA
3exhE Crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex (see paper)
38% identity, 96% coverage: 12:333/334 of query aligns to 25:312/331 of 3exhE
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
30% identity, 96% coverage: 13:331/334 of query aligns to 31:349/367 of Q5SLR4
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
30% identity, 96% coverage: 13:331/334 of query aligns to 26:344/362 of 1umdA
- active site: I52 (≠ V39), S139 (≠ G126), R264 (= R251), H268 (= H255), S269 (≠ F256), Y277 (= Y263)
- binding 2-oxo-4-methylpentanoic acid: F61 (= F49), Y90 (≠ H77), S139 (≠ G126)
- binding magnesium ion: D170 (= D157), N199 (= N186), Y201 (= Y188)
- binding thiamine diphosphate: Y89 (≠ T76), Y90 (≠ H77), R91 (= R78), P140 (≠ I127), I141 (≠ L128), G169 (= G156), D170 (= D157), G171 (= G158), N199 (= N186), Y201 (= Y188), A202 (= A189), I203 (≠ E190), H268 (= H255)
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
30% identity, 96% coverage: 13:331/334 of query aligns to 26:344/362 of 1umcA
- active site: I52 (≠ V39), S139 (≠ G126), R264 (= R251), H268 (= H255), S269 (≠ F256), Y277 (= Y263)
- binding 4-methyl valeric acid: Y90 (≠ H77), H126 (= H113)
- binding magnesium ion: D170 (= D157), N199 (= N186), Y201 (= Y188)
- binding thiamine diphosphate: Y89 (≠ T76), Y90 (≠ H77), R91 (= R78), I141 (≠ L128), G169 (= G156), D170 (= D157), G171 (= G158), N199 (= N186), Y201 (= Y188), I203 (≠ E190), H268 (= H255)
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
30% identity, 96% coverage: 13:331/334 of query aligns to 26:344/362 of 1umbA
- active site: I52 (≠ V39), S139 (≠ G126), R264 (= R251), H268 (= H255), S269 (≠ F256), Y277 (= Y263)
- binding magnesium ion: D170 (= D157), N199 (= N186), Y201 (= Y188)
- binding thiamine diphosphate: Y89 (≠ T76), Y90 (≠ H77), R91 (= R78), P140 (≠ I127), I141 (≠ L128), G169 (= G156), D170 (= D157), G171 (= G158), N199 (= N186), Y201 (= Y188), A202 (= A189), I203 (≠ E190), H268 (= H255)
3dufA Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
30% identity, 95% coverage: 15:331/334 of query aligns to 38:345/365 of 3dufA
- active site: S62 (≠ D40), I139 (≠ G126), R264 (= R251), H268 (= H255), T269 (vs. gap), Y278 (≠ R264)
- binding magnesium ion: D170 (= D157), N199 (= N186), F201 (≠ Y188)
- binding 2-{4-[(4-amino-2-methylpyrimidin-5-yl)methyl]-5-[(1r)-1-hydroxyethyl]-3-methyl-2-thienyl}ethyl trihydrogen diphosphate: Y99 (≠ H77), R100 (= R78), I141 (≠ L128), G169 (= G156), D170 (= D157), G171 (= G158), N199 (= N186), F201 (≠ Y188), A202 (= A189), H268 (= H255)
1w85A The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
30% identity, 95% coverage: 15:331/334 of query aligns to 38:339/358 of 1w85A
- active site: S62 (≠ D40), I139 (≠ G126), R264 (= R251), H268 (= H255), T269 (vs. gap)
- binding magnesium ion: D170 (= D157), N199 (= N186), F201 (≠ Y188)
- binding thiamine diphosphate: Y99 (≠ H77), R100 (= R78), I139 (≠ G126), I141 (≠ L128), G169 (= G156), D170 (= D157), G171 (= G158), G172 (≠ A159), N199 (= N186), A202 (= A189), I203 (≠ E190), H268 (= H255)
Query Sequence
>RR42_RS21725 FitnessBrowser__Cup4G11:RR42_RS21725
MTANASGTAGNTLPLDKQELLAVYRRMRTIRDFEERLHVDFGRGDIPGFVHLYAGEEAAG
VGILHHLGDGDRIASTHRGHGHCIAKGVDPVAMMKEIYGRKGGSCNGKGGSMHIADLSKG
MMGANGILGAGAPLVCGAALAAKFRGKGEIGITFAGDGASNQGTFLESLNLAAVWNLPVI
FVIENNGYAESTARDYGTAVDSYVDRAAGFGIPGVTVDGTDFFAVHEAAGEVIKRAREGG
GPALLECKMVRFYGHFEGDAQTYRASGELDDIRANKDCLKKFTATVTQAGVIALDELKAI
DEQVAALIEDAVQQAKAAPFPTPADLLTDVYVSY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory