SitesBLAST
Comparing RR42_RS21765 FitnessBrowser__Cup4G11:RR42_RS21765 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
67% identity, 99% coverage: 2:245/246 of query aligns to 3:245/245 of 5t5qC
- active site: G18 (= G17), S140 (= S140), N150 (= N150), Y153 (= Y153), K157 (= K157)
- binding nicotinamide-adenine-dinucleotide: N16 (= N15), G17 (= G16), G18 (= G17), I19 (= I18), D38 (= D37), L39 (= L38), D63 (= D63), A64 (= A64), S90 (= S90), I113 (= I113), Y153 (= Y153), K157 (= K157), P182 (= P182), I185 (= I185), T187 (= T187), M189 (= M189)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 98% coverage: 3:244/246 of query aligns to 2:243/244 of 6t77A
- active site: G16 (= G17), S138 (= S140), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ N15), R15 (≠ G16), T37 (≠ L38), L58 (≠ M62), N59 (≠ D63), V60 (≠ A64), A87 (= A91), G88 (= G92), I89 (≠ L93)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 98% coverage: 3:244/246 of query aligns to 5:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ N15), R18 (≠ G16), I20 (= I18), T40 (≠ L38), N62 (≠ D63), V63 (≠ A64), N89 (≠ S90), A90 (= A91), I92 (≠ L93), V139 (≠ L138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P182), G185 (= G183), I187 (= I185), T189 (= T187), M191 (= M189)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
38% identity, 98% coverage: 3:244/246 of query aligns to 1:242/243 of 7emgB
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 98% coverage: 3:244/246 of query aligns to 2:243/244 of P0AEK2
- GASR 12:15 (≠ GANG 13:16) binding
- T37 (≠ L38) binding
- NV 59:60 (≠ DA 63:64) binding
- N86 (≠ S90) binding
- Y151 (= Y153) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSASK 153:157) binding
- A154 (≠ S156) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K157) mutation to A: Defect in the affinity for NADPH.
- I184 (= I185) binding
- E233 (= E234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
37% identity, 98% coverage: 3:244/246 of query aligns to 1:242/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ Q106), S137 (= S140), Q147 (≠ N150), Y150 (= Y153), K154 (= K157)
- binding calcium ion: E232 (= E234), T233 (≠ V235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ N15), R14 (≠ G16), T36 (≠ L38), N58 (≠ D63), V59 (≠ A64), N85 (≠ S90), A86 (= A91), G87 (= G92), I88 (≠ L93), S137 (= S140), Y150 (= Y153), K154 (= K157), P180 (= P182), G181 (= G183), I183 (= I185)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
37% identity, 98% coverage: 3:244/246 of query aligns to 2:243/244 of P0A2C9
- M125 (≠ L129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ C224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
36% identity, 98% coverage: 3:244/246 of query aligns to 1:242/243 of 1q7cA
- active site: G15 (= G17), S137 (= S140), Q147 (≠ N150), F150 (≠ Y153), K154 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ N15), R14 (≠ G16), A35 (≠ D37), T36 (≠ L38), L57 (≠ M62), N58 (≠ D63), V59 (≠ A64), G87 (= G92), I88 (≠ L93)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 99% coverage: 1:244/246 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N114), S139 (= S140), Q149 (≠ N150), Y152 (= Y153), K156 (= K157)
- binding acetoacetyl-coenzyme a: D93 (≠ A96), K98 (≠ E101), S139 (= S140), N146 (≠ A147), V147 (≠ Y148), Q149 (≠ N150), Y152 (= Y153), F184 (≠ V184), M189 (= M189), K200 (≠ D200)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ L38), V59 (≠ M62), D60 (= D63), V61 (≠ A64), N87 (≠ S90), A88 (= A91), G89 (= G92), I90 (≠ L93), T137 (≠ L138), S139 (= S140), Y152 (= Y153), K156 (= K157), P182 (= P182), F184 (≠ V184), T185 (≠ I185), T187 (= T187), M189 (= M189)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 98% coverage: 3:244/246 of query aligns to 5:242/243 of 4i08A
- active site: G19 (= G17), N113 (= N114), S141 (= S140), Q151 (≠ N150), Y154 (= Y153), K158 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ N15), R18 (≠ G16), I20 (= I18), T40 (≠ L38), N62 (≠ D63), V63 (≠ A64), N89 (≠ S90), A90 (= A91), G140 (≠ T139), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P182), G185 (= G183), T189 (= T187)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
38% identity, 98% coverage: 5:245/246 of query aligns to 4:244/244 of 6wprA
- active site: G16 (= G17), S138 (= S140), Y151 (= Y153)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ N15), R15 (≠ G16), T37 (≠ L38), L58 (≠ M62), D59 (= D63), V60 (≠ A64), N86 (≠ S90), A87 (= A91), G88 (= G92), I89 (≠ L93), I136 (≠ L138), Y151 (= Y153), K155 (= K157), P181 (= P182)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
38% identity, 98% coverage: 5:245/246 of query aligns to 4:244/244 of 6t62A
- active site: G16 (= G17), S138 (= S140), Y151 (= Y153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ N15), R15 (≠ G16), A36 (≠ D37), T37 (≠ L38), L58 (≠ M62), D59 (= D63), V60 (≠ A64), N86 (≠ S90), A87 (= A91), G88 (= G92), I89 (≠ L93), I136 (≠ L138), S137 (≠ T139), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P182), G182 (= G183), I184 (= I185), M188 (= M189)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 98% coverage: 4:245/246 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G17), S142 (= S140), I152 (≠ N150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L207), R211 (≠ K208), R212 (= R209)
- binding bicarbonate ion: I92 (≠ L93), G94 (vs. gap), R109 (≠ Q109), R179 (= R176), S228 (= S225)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ N15), N15 (≠ G16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ L38), D62 (= D63), T63 (≠ A64), N89 (≠ S90), A90 (= A91), G91 (= G92), I140 (≠ L138), Y155 (= Y153), K159 (= K157), P185 (= P182), A186 (≠ G183), I188 (= I185), T190 (= T187)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 98% coverage: 4:245/246 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G17), S142 (= S140), I152 (≠ N150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ L93), S93 (≠ Y94), G94 (vs. gap), E95 (≠ Q95), T97 (≠ Q97), E101 (= E101), T103 (≠ S103), Q106 (= Q106), R109 (≠ Q109), S175 (≠ P173), G177 (vs. gap)
- binding magnesium ion: S237 (≠ E234), Y238 (≠ V235)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ N15), N15 (≠ G16), G16 (= G17), I17 (= I18), D36 (= D37), I37 (≠ L38), W41 (≠ A41), D62 (= D63), T63 (≠ A64), N89 (≠ S90), A90 (= A91), G91 (= G92), I140 (≠ L138), Y155 (= Y153), K159 (= K157), P185 (= P182), I188 (= I185), T190 (= T187)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 98% coverage: 4:245/246 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G17), S142 (= S140), I152 (≠ N150), Y155 (= Y153), K159 (= K157)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ G16), G16 (= G17), I17 (= I18), N89 (≠ S90), G91 (= G92), Y155 (= Y153), P185 (= P182), A186 (≠ G183)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 98% coverage: 1:241/246 of query aligns to 2:251/255 of 5itvA
- active site: G18 (= G17), S141 (= S140), Y154 (= Y153), K158 (= K157)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ L38), T61 (≠ M62), I63 (≠ A64), N89 (≠ S90), G91 (= G92), T139 (≠ L138), S141 (= S140), Y154 (= Y153), K158 (= K157), P184 (= P182), G185 (= G183), I186 (≠ V184), I187 (= I185)
4iinA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with NAD+
35% identity, 98% coverage: 4:244/246 of query aligns to 4:236/236 of 4iinA
- active site: G17 (= G17), S143 (= S140), Y156 (= Y153), K160 (= K157)
- binding nicotinamide-adenine-dinucleotide: G13 (= G13), G17 (= G17), I18 (= I18), N36 (≠ T36), R38 (≠ L38), A65 (= A64), N91 (≠ S90), A92 (= A91), G93 (= G92), V141 (≠ L138), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P182)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 97% coverage: 7:244/246 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S140), Q148 (≠ N150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ N15), R11 (≠ G16), I13 (= I18), N31 (≠ T36), Y32 (≠ D37), A33 (≠ L38), G34 (vs. gap), S35 (≠ D39), A58 (≠ M62), N59 (≠ D63), V60 (≠ A64), N86 (≠ S90), A87 (= A91), T109 (≠ I113), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P182), G182 (= G183)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 97% coverage: 7:244/246 of query aligns to 5:246/246 of 3osuA
8jfgA Crystal structure of 3-oxoacyl-acp reductase fabg in complex with NADP+ and 3-keto-octanoyl-acp from helicobacter pylori (see paper)
36% identity, 98% coverage: 4:244/246 of query aligns to 4:248/248 of 8jfgA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), K16 (≠ G16), I18 (= I18), R38 (≠ L38), A65 (= A64), N91 (≠ S90), A92 (= A91), G93 (= G92), A142 (≠ T139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P182), I189 (= I185), T191 (= T187), M193 (= M189), N194 (≠ T190)
- binding ~{S}-[2-[3-[[(2~{S})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] 3-oxidanylideneoctanethioate: D97 (≠ A96), S143 (= S140), I145 (≠ A142), M151 (≠ Y148), G152 (≠ Y149), Q153 (≠ N150), Y156 (= Y153), G187 (= G183), F188 (≠ V184), Y205 (≠ S201)
Query Sequence
>RR42_RS21765 FitnessBrowser__Cup4G11:RR42_RS21765
MYNFDQRTLLLTGANGGIGRETAKLFLAQGANLVLTDLDEAGVAGFARELDPSGERIATM
RMDAASPDDCERAVALAQARFGGIDFLVPSAGLYQAQPVAEMSDAQWRQTLSINLDGVFY
LVRRAIPALRENSAIVNLTSVAAHRGAYYNAHYSASKGGLLSLTRSLARELGPRTRVNAV
SPGVIETPMTTELIQKRGADSVEQTPLKRLGHPREIATAIGFLCSDAASFVTGEVLHVNG
GLYIAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory