Comparing RR42_RS21785 FitnessBrowser__Cup4G11:RR42_RS21785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
35% identity, 44% coverage: 401:723/729 of query aligns to 2:322/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
35% identity, 44% coverage: 401:723/729 of query aligns to 2:322/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
35% identity, 44% coverage: 401:723/729 of query aligns to 2:322/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
35% identity, 44% coverage: 401:723/729 of query aligns to 2:322/324 of 1w85B
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
36% identity, 40% coverage: 404:693/729 of query aligns to 7:308/338 of 1qs0B
P35486 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Mus musculus (Mouse) (see 2 papers)
35% identity, 43% coverage: 38:353/729 of query aligns to 68:357/390 of P35486
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
37% identity, 41% coverage: 412:710/729 of query aligns to 13:320/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
37% identity, 41% coverage: 412:710/729 of query aligns to 13:320/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
37% identity, 41% coverage: 412:710/729 of query aligns to 13:320/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
37% identity, 41% coverage: 412:710/729 of query aligns to 14:321/324 of Q5SLR3
P26284 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Rattus norvegicus (Rat) (see paper)
35% identity, 43% coverage: 38:353/729 of query aligns to 68:357/390 of P26284
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
33% identity, 44% coverage: 406:723/729 of query aligns to 37:357/359 of P11177
Sites not aligning to the query:
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
33% identity, 44% coverage: 406:724/729 of query aligns to 9:330/331 of 6cerD
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
33% identity, 44% coverage: 406:724/729 of query aligns to 8:329/330 of 6cfoB
P16387 Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; Pyruvate dehydrogenase complex component E1 alpha; PDHE1-A; EC 1.2.4.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
34% identity, 48% coverage: 29:379/729 of query aligns to 79:394/420 of P16387
Sites not aligning to the query:
P29803 Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial; PDHE1-A type II; EC 1.2.4.1 from Homo sapiens (Human) (see 4 papers)
33% identity, 43% coverage: 41:353/729 of query aligns to 69:355/388 of P29803
P08559 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial; PDHE1-A type I; EC 1.2.4.1 from Homo sapiens (Human) (see 13 papers)
35% identity, 43% coverage: 38:353/729 of query aligns to 68:357/390 of P08559
Sites not aligning to the query:
6cfoA Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
35% identity, 43% coverage: 38:353/729 of query aligns to 40:329/362 of 6cfoA
1ni4A Human pyruvate dehydrogenase (see paper)
35% identity, 43% coverage: 38:353/729 of query aligns to 40:329/362 of 1ni4A
3exeA Crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex (see paper)
35% identity, 43% coverage: 38:353/729 of query aligns to 41:330/363 of 3exeA
>RR42_RS21785 FitnessBrowser__Cup4G11:RR42_RS21785
MSERSALRPAAEWVELRTTDEDWAKADPALLGTLLSHLHLIRGFEEAVLELAAEGLVHGP
AHSSIGQEGGAAGSIVPLTGADQINGSHRGHHQFISKALGYLAPNGIDPRAPLPADVQTL
LQRTLAEILGLAQGYCKGRGGSMHLQWAEAGALGTNAIVGGGVPMAAGAAWSHRHAGTDA
VAITYFGDGAVNIGSVLETMNLAAAWKLPLCFFIENNRYAVSTTVEESTAEPRLSARGMG
FNIPSWKVDGMDPLAVYLATREALAHMRAGKGPTIIEADLYRFFHQNGPFPGSAFGYRSK
DEEQQWRARDPLELMARRMQARGLISADDVAALRERIKQAMRDAMAALTEADPSGKPGKR
RIRPELWPSPDFRDVGIRGDLGELAGLRCEEEAGFCGKLDQRKFIDVVADVMQRRMETDP
SVVVMGEDVHRLKGGTNGATRGLRDNFPDRVLGTPISENAFVGLGGGLALDGRYKPVVEF
MYPDFMWVAADQVFNQIGKARHMFGGESDVPLVLRTKVAMGTGYGSQHSMDPAGIFATNP
GWRIVAPSTPFDYVGLMNTALACKDPVLVIEHVDLYNASGVGPVDDFDYHLPVGKAAVRR
GGSDVTVITYLSMVGHSLEAVEQTGIDAEVIDLRWLDRASIDWDTIAQSVRKTNNVLIVE
QGARGTSYGGWLADEIQRRYFDWLDQPVQRVTGAEAAPSISKVLERAAAARTEEVAEGLR
QVMRDKGAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory