SitesBLAST
Comparing RR42_RS21790 FitnessBrowser__Cup4G11:RR42_RS21790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
39% identity, 98% coverage: 4:249/252 of query aligns to 6:247/248 of 6ixmC
- active site: G16 (= G14), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (= S13), G16 (= G14), I17 (= I15), D36 (= D34), I37 (≠ L35), A61 (= A61), D62 (≠ S62), T63 (≠ I63), N89 (= N89), A90 (= A90), M140 (≠ T139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), A186 (≠ G185), Y187 (= Y186), I188 (≠ T187), L192 (= L191)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 98% coverage: 1:247/252 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G14), S142 (= S141), Q152 (≠ R151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (≠ S13), G16 (= G14), I17 (= I15), N35 (≠ L33), Y36 (≠ D34), N37 (≠ L35), G38 (≠ D36), S39 (≠ A37), N63 (≠ S62), V64 (≠ I63), N90 (= N89), A91 (= A90), I93 (= I92), I113 (= I112), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ T187), T190 (= T189)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
39% identity, 99% coverage: 1:249/252 of query aligns to 5:254/255 of 5itvA
- active site: G18 (= G14), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (= S13), G18 (= G14), I19 (= I15), D38 (= D34), I39 (≠ L35), T61 (≠ A61), I63 (= I63), N89 (= N89), G91 (= G91), T139 (= T139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I186 (≠ Y186), I187 (≠ T187)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
39% identity, 96% coverage: 4:246/252 of query aligns to 8:241/244 of 4nbuB
- active site: G18 (= G14), N111 (≠ D113), S139 (= S141), Q149 (≠ R151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ N95), K98 (≠ E100), S139 (= S141), N146 (≠ S148), V147 (≠ A149), Q149 (≠ R151), Y152 (= Y154), F184 (≠ Y186), M189 (≠ L191), K200 (≠ A205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), N17 (≠ S13), G18 (= G14), I19 (= I15), D38 (= D34), F39 (≠ L35), V59 (≠ A61), D60 (≠ S62), V61 (≠ I63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (= I92), T137 (= T139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (≠ Y186), T185 (= T187), T187 (= T189), M189 (≠ L191)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
44% identity, 99% coverage: 1:249/252 of query aligns to 3:238/240 of 2d1yA
- active site: G16 (= G14), S135 (= S141), N145 (≠ R151), Y148 (= Y154), K152 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), R15 (≠ S13), I17 (= I15), D36 (= D34), L37 (= L35), R38 (≠ D36), V55 (= V54), D56 (≠ Q55), L57 (≠ V56), N83 (= N89), A84 (= A90), A85 (≠ G91), I86 (= I92), V133 (≠ T139), S135 (= S141), Y148 (= Y154), K152 (= K158), P178 (= P184), G179 (= G185), I181 (≠ T187), T183 (= T189), A185 (≠ L191), V186 (≠ M192)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
38% identity, 99% coverage: 1:249/252 of query aligns to 5:226/227 of 5itvD
- active site: G18 (= G14), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (= S13), G18 (= G14), I19 (= I15), D38 (= D34), I39 (≠ L35), T61 (≠ A61), D62 (≠ S62), I63 (= I63), N89 (= N89), T139 (= T139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I187 (≠ M192)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
39% identity, 99% coverage: 1:249/252 of query aligns to 8:252/258 of 4wecA
- active site: G21 (= G14), S143 (= S141), Q154 (≠ R151), Y157 (= Y154), K161 (= K158)
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), A19 (= A12), S20 (= S13), G21 (= G14), I22 (= I15), D41 (= D34), I42 (≠ L35), V61 (≠ A61), D62 (≠ S62), V63 (≠ I63), N89 (= N89), T141 (= T139), Y157 (= Y154), K161 (= K158), P187 (= P184), P189 (≠ Y186), V190 (≠ T187)
1iy8A Crystal structure of levodione reductase (see paper)
37% identity, 98% coverage: 4:249/252 of query aligns to 5:256/258 of 1iy8A
- active site: G15 (= G14), S143 (= S141), Q153 (≠ R151), Y156 (= Y154), K160 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), S14 (= S13), G15 (= G14), L16 (≠ I15), D35 (= D34), V36 (≠ L35), A62 (= A61), D63 (≠ S62), V64 (≠ I63), N90 (= N89), G92 (= G91), I93 (= I92), T141 (= T139), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), T191 (= T189), P192 (≠ A190), M193 (≠ L191)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
37% identity, 98% coverage: 4:249/252 of query aligns to 14:265/267 of Q9LBG2
- 17:42 (vs. 7:32, 58% identical) binding
- E103 (≠ S93) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
38% identity, 98% coverage: 1:246/252 of query aligns to 3:236/239 of 4nbtA
- active site: G16 (= G14), S132 (= S141), Y145 (= Y154), K149 (= K158)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), K15 (≠ S13), G16 (= G14), L17 (≠ I15), D36 (= D34), L37 (= L35), L52 (≠ A61), N53 (≠ S62), V54 (≠ I63), N80 (= N89), A81 (= A90), G82 (= G91), I130 (≠ T139), S132 (= S141), Y145 (= Y154), K149 (= K158), P177 (= P184), G178 (= G185), I180 (≠ T187), T182 (= T189)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
36% identity, 99% coverage: 1:249/252 of query aligns to 9:248/254 of 3o03A
- active site: G22 (= G14), S147 (= S141), V157 (≠ R151), Y160 (= Y154), K164 (= K158)
- binding calcium ion: S147 (= S141), M148 (= M142), P190 (= P184)
- binding D-gluconic acid: I99 (≠ S93), R101 (≠ N95), S147 (= S141), M149 (≠ W143), R154 (≠ S148), Y160 (= Y154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G10), Y21 (≠ S13), G22 (= G14), I23 (= I15), D42 (= D34), I43 (≠ L35), L47 (vs. gap), D68 (≠ S62), V69 (≠ I63), N95 (= N89), A96 (= A90), G97 (= G91), I145 (≠ T139), Y160 (= Y154), K164 (= K158), P190 (= P184)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 98% coverage: 1:247/252 of query aligns to 4:244/247 of P73574
- A14 (≠ G11) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ A149) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K158) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ Y186) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ D202) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
37% identity, 99% coverage: 1:249/252 of query aligns to 4:250/251 of 1zk1A
- active site: G17 (= G14), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding 1-phenylethanone: A93 (≠ S93), N95 (= N95), Y155 (= Y154), Y189 (= Y186)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), L16 (≠ S13), I18 (= I15), D37 (= D34), H61 (≠ A61), D62 (≠ S62), S63 (≠ I63), N89 (= N89), A90 (= A90), I92 (= I92), M140 (≠ T139), Y155 (= Y154), G188 (= G185), I190 (≠ T187), L194 (= L191)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
37% identity, 99% coverage: 1:249/252 of query aligns to 4:250/251 of 1zjzA
- active site: G17 (= G14), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), L16 (≠ S13), I18 (= I15), D37 (= D34), D62 (≠ S62), N89 (= N89), A90 (= A90), G91 (= G91), I92 (= I92), Y155 (= Y154), G188 (= G185), I190 (≠ T187), L194 (= L191)
- binding (1r)-1-phenylethanol: A93 (≠ S93), N95 (= N95), L152 (≠ R151), Y155 (= Y154)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
37% identity, 99% coverage: 1:249/252 of query aligns to 4:250/251 of 1zjyA
- active site: G17 (= G14), S142 (= S141), Y155 (= Y154), K159 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G10), L16 (≠ S13), G17 (= G14), I18 (= I15), D37 (= D34), D62 (≠ S62), N89 (= N89), A90 (= A90), G91 (= G91), I92 (= I92), Y155 (= Y154), G188 (= G185), I190 (≠ T187), L194 (= L191)
- binding (1r)-1-phenylethanol: A93 (≠ S93), N95 (= N95), L152 (≠ R151), Y155 (= Y154), Y189 (= Y186)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 99% coverage: 1:250/252 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G14), S143 (= S141), I154 (≠ L152), Y157 (= Y154), K161 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), R16 (≠ S13), G17 (= G14), L18 (≠ I15), S37 (≠ D34), R38 (≠ L35), C63 (≠ A61), D64 (≠ S62), V65 (≠ I63), A91 (≠ N89), A92 (= A90), G93 (= G91), I94 (= I92), V114 (≠ I112), I141 (≠ T139), S143 (= S141), Y157 (= Y154), K161 (= K158), P187 (= P184), G188 (= G185), Y190 (≠ T187), T192 (= T189), M194 (≠ L191), T195 (≠ M192)
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
42% identity, 99% coverage: 1:249/252 of query aligns to 4:244/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G10), I16 (= I15), D34 (= D34), L35 (= L35), R36 (≠ D36), V53 (= V54), L55 (≠ V56), N81 (= N89), A82 (= A90), A83 (≠ G91), Y146 (= Y154)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
40% identity, 98% coverage: 1:246/252 of query aligns to 7:247/251 of 6d9yB
- active site: G20 (= G14), S145 (= S141), Y158 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G16 (= G10), R19 (≠ S13), G20 (= G14), D40 (= D34), L41 (= L35), V64 (≠ A61), D65 (≠ S62), Q66 (≠ I63), A93 (= A90), S145 (= S141), Y158 (= Y154), K162 (= K158), P188 (= P184), A189 (≠ G185), A190 (≠ Y186), A191 (≠ T187), T193 (= T189)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
37% identity, 99% coverage: 1:249/252 of query aligns to 4:259/260 of 6zzqA
- active site: G17 (= G14), S142 (= S141), Y155 (= Y154)
- binding acetoacetic acid: Q94 (≠ S93), S142 (= S141), K152 (≠ R151), Y155 (= Y154), Q196 (≠ L195)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), S16 (= S13), G17 (= G14), I18 (= I15), D37 (= D34), M38 (≠ L35), D63 (≠ S62), V64 (≠ I63), N90 (= N89), A91 (= A90), G92 (= G91), M140 (≠ T139), A141 (= A140), S142 (= S141), Y155 (= Y154), K159 (= K158), Y187 (= Y186), V188 (≠ T187), T190 (= T189)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
37% identity, 98% coverage: 3:249/252 of query aligns to 7:260/261 of 6zzsD
- active site: G18 (= G14), S143 (= S141), Y156 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), S17 (= S13), I19 (= I15), D38 (= D34), M39 (≠ L35), D64 (≠ S62), V65 (≠ I63), N91 (= N89), A92 (= A90), G93 (= G91), M141 (≠ T139), A142 (= A140), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (= P184), G187 (= G185), V189 (≠ T187), T191 (= T189), L193 (= L191)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ S93), S143 (= S141), N145 (≠ W143), K153 (≠ R151), Y156 (= Y154), Q197 (≠ L195)
Query Sequence
>RR42_RS21790 FitnessBrowser__Cup4G11:RR42_RS21790
MAGKVVLNTGGASGIGRAMAHGFARHGARLMLLDLDAQGLASAKAELEAAYPEVQVEIVK
ASITDPDAVEQACAATEARFGRIDILLNNAGISMNKPSLELTPDDWRRAIDIDLSGVFFC
TQAAARRMVRQGGGSILSTASMWGLASSARRLAYCAAKAGVVSLTKSLAAEWAEYNIRVN
AVCPGYTSTALMETLLASKAIDGEALLARTPLRRFGAPEEMAEVALFLASDSAAFITGHA
LVSDGGWTADGF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory