Comparing RR42_RS21850 FitnessBrowser__Cup4G11:RR42_RS21850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
52% identity, 99% coverage: 1:260/262 of query aligns to 1:259/261 of 2xuaH
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
28% identity, 100% coverage: 1:261/262 of query aligns to 1:261/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 100% coverage: 1:261/262 of query aligns to 1:264/268 of 6eb3B
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
28% identity, 97% coverage: 2:256/262 of query aligns to 8:263/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
28% identity, 97% coverage: 2:256/262 of query aligns to 8:263/274 of 4uhdA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
28% identity, 97% coverage: 2:256/262 of query aligns to 8:263/278 of 4uhfA
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
29% identity, 100% coverage: 1:261/262 of query aligns to 1:258/262 of 6eb3C
1q0zA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin a (dcma) (see paper)
27% identity, 74% coverage: 48:240/262 of query aligns to 51:272/297 of 1q0zA
1q0rA Crystal structure of aclacinomycin methylesterase (rdmc) with bound product analogue, 10-decarboxymethylaclacinomycin t (dcmat) (see paper)
27% identity, 74% coverage: 48:240/262 of query aligns to 51:272/297 of 1q0rA
5dnuA Crystal structure of striga kai2-like protein in complex with karrikin (see paper)
22% identity, 87% coverage: 24:250/262 of query aligns to 18:252/267 of 5dnuA
O07732 Bifunctional lipase/adenylate cyclase LipJ; EC 3.1.1.-; EC 4.6.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 76% coverage: 49:246/262 of query aligns to 63:267/462 of O07732
Sites not aligning to the query:
5zhtA Crystal structure of osd14 in complex with covalently bound kk073 (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 18:258/265 of 5zhtA
5zhrA Crystal structure of osd14 in complex with covalently bound kk094 (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 18:258/265 of 5zhrA
5yz7A Crystal structure of osd14 in complex with d-ring-opened 7'-carba-4bd (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 18:258/265 of 5yz7A
6brtA F-box protein cth with hydrolase (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 38:278/285 of 6brtA
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 19:259/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 19:259/266 of 5dj5A
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 21:261/268 of 4ihaA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
24% identity, 89% coverage: 23:256/262 of query aligns to 17:257/264 of 5zhsA
Q10QA5 Strigolactone esterase D14; Protein DWARF 14; Protein DWARF 88; Protein HIGH-TILLERING DWARF 2; EC 3.1.-.- from Oryza sativa subsp. japonica (Rice) (see 4 papers)
24% identity, 89% coverage: 23:256/262 of query aligns to 71:311/318 of Q10QA5
>RR42_RS21850 FitnessBrowser__Cup4G11:RR42_RS21850
MTTALHQGIALHYEIEGAPNAPVLVMSNSLGTDMQMWAPQMDSLLPRFRVLRYDTRGHGG
SGLPSPAAAPFGFAELGQDVLAIMDHAGIQRAHFCGLSMGGMTGMWLAANHPERFDRFVL
ANTAALIGPASGWDTRIQTVRSQGMAAIVDAVLARWFSAAWLAGNAARIAPVRQMLLDAS
PEGYTANCAAVRDADLRAQLQRIASPVLVIAGTHDLATTPAQGREVAQGIAGARYVELDG
AHLSNWEQPEGFAQAVCGFLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory