SitesBLAST
Comparing RR42_RS22175 FitnessBrowser__Cup4G11:RR42_RS22175 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iqdA Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis
45% identity, 87% coverage: 14:264/288 of query aligns to 21:263/290 of 4iqdA
- active site: Y46 (= Y39), S48 (= S41), G49 (= G42), A50 (= A43), D60 (= D54), D87 (= D81), D89 (= D83), Q114 (= Q108), E116 (= E110), K122 (= K116), C124 (= C118), G125 (= G119), H126 (= H120), R157 (= R153), E187 (= E183), N209 (= N207)
- binding pyruvic acid: E71 (≠ D65), R72 (≠ I66), D75 (≠ R69), G165 (= G161), L166 (= L162), Y218 (≠ V216), Y219 (≠ Q217)
Q56062 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
43% identity, 89% coverage: 10:264/288 of query aligns to 14:267/295 of Q56062
- SGG 45:47 (≠ SGA 41:43) binding
- D58 (= D54) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- D85 (= D81) binding
- K121 (= K116) mutation to A: 1000-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R122 (= R117) mutation to K: 2-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- C123 (= C118) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- H125 (= H120) mutation to A: 750-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R158 (= R153) binding
1mumA Structure of the 2-methylisocitrate lyase (prpb) from escherichia coli (see paper)
43% identity, 92% coverage: 1:264/288 of query aligns to 1:265/289 of 1mumA
- active site: Y41 (= Y39), S43 (= S41), G44 (= G42), G45 (≠ A43), D56 (= D54), D83 (= D81), D85 (= D83), H111 (≠ Q108), E113 (= E110), K119 (= K116), C121 (= C118), G122 (= G119), H123 (= H120), R156 (= R153), E186 (= E183), N208 (= N207), T215 (= T214), L217 (≠ V216)
- binding magnesium ion: D56 (= D54), D85 (= D83)
P77541 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 89% coverage: 10:264/288 of query aligns to 14:267/296 of P77541
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 270 binding
1o5qA Crystal structure of pyruvate and mg2+ bound 2-methylisocitrate lyase (prpb) from salmonella typhimurium (see paper)
40% identity, 89% coverage: 10:264/288 of query aligns to 10:252/271 of 1o5qA
- active site: Y39 (= Y39), S41 (= S41), G42 (= G42), G43 (≠ A43), D54 (= D54), D81 (= D81), D83 (= D83), H109 (≠ Q108), E111 (= E110), R143 (= R153), E173 (= E183), N195 (= N207), T202 (= T214), L204 (≠ V216)
- binding pyruvic acid: Y39 (= Y39), S41 (= S41), G43 (≠ A43), D81 (= D81), R143 (= R153)
6t4vC Crystal structure of 2-methylisocitrate lyase (prpb) from pseudomonas aeruginosa in apo form.
42% identity, 86% coverage: 16:264/288 of query aligns to 18:254/277 of 6t4vC
- active site: Y41 (= Y39), S43 (= S41), G44 (= G42), G45 (≠ A43), D56 (= D54), D83 (= D81), D85 (= D83), H111 (≠ Q108), E113 (= E110), R145 (= R153), E175 (= E183), N197 (= N207), T204 (= T214), L206 (≠ V216)
- binding pyruvic acid: F88 (≠ Y86), N94 (= N91)
3fa3B Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form (see paper)
40% identity, 80% coverage: 5:233/288 of query aligns to 8:239/302 of 3fa3B
- active site: Y43 (= Y39), T45 (≠ S41), G46 (= G42), A47 (= A43), D58 (= D54), D86 (= D81), D88 (= D83), H113 (≠ Q108), E115 (= E110), K121 (= K116), C123 (= C118), G124 (= G119), H125 (= H120), R160 (= R153), E190 (= E183), N213 (= N207), T220 (= T214), S222 (≠ V216)
- binding 2,2-difluoro-3,3-dihydroxybutanedioic acid: Y43 (= Y39), T45 (≠ S41), G46 (= G42), A47 (= A43), D86 (= D81), G124 (= G119), R160 (= R153), E190 (= E183), N213 (= N207), P239 (= P233)
Q05957 Petal death protein; (R)-2-methylmalate lyase; D-citramalate lyase; Oxalacetic hydrolase; PSR132; EC 3.7.1.1; EC 4.1.3.- from Dianthus caryophyllus (Carnation) (Clove pink) (see 2 papers)
40% identity, 90% coverage: 16:274/288 of query aligns to 41:298/318 of Q05957
- D79 (= D54) mutation to A: Reduces catalytic efficiency 1000-fold.
- D107 (= D81) binding
- D109 (= D83) binding
- K142 (= K116) binding
- C144 (= C118) mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 1:3 modified: propeptide, Removed in mature form
1zlpB Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
40% identity, 90% coverage: 16:274/288 of query aligns to 14:271/285 of 1zlpB
- active site: F37 (≠ Y39), S39 (= S41), G40 (= G42), Y41 (≠ A43), D52 (= D54), D80 (= D81), D82 (= D83), F107 (≠ Q108), E109 (= E110), K115 (= K116), C117 (= C118), G118 (= G119), H119 (= H120), R152 (= R153), E182 (= E183), N204 (= N207), T211 (= T214), L213 (≠ V216)
- binding 5-hydroxypentanal: Y41 (≠ A43), C117 (= C118), R152 (= R153), I206 (≠ V209)
1zlpA Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
40% identity, 90% coverage: 16:274/288 of query aligns to 14:271/284 of 1zlpA
- active site: F37 (≠ Y39), S39 (= S41), G40 (= G42), Y41 (≠ A43), D52 (= D54), D80 (= D81), D82 (= D83), F107 (≠ Q108), E109 (= E110), K115 (= K116), C117 (= C118), G118 (= G119), H119 (= H120), R152 (= R153), E182 (= E183), N204 (= N207), T211 (= T214), L213 (≠ V216)
- binding 5-hydroxypentanal: C117 (= C118), G118 (= G119), R152 (= R153), I206 (≠ V209)
- binding magnesium ion: D80 (= D81), K115 (= K116)
3m0jA Structure of oxaloacetate acetylhydrolase in complex with the inhibitor 3,3-difluorooxalacetate (see paper)
36% identity, 92% coverage: 15:280/288 of query aligns to 20:271/297 of 3m0jA
- binding calcium ion: E218 (= E210), N219 (≠ G211)
- binding 2,2-difluoro-3,3-dihydroxybutanedioic acid: Y44 (= Y39), T46 (≠ S41), G47 (= G42), A48 (= A43), D88 (= D81), G126 (= G119), R162 (= R153), E192 (= E183), N215 (= N207), S241 (≠ P233)
3fa3J Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, trigonal crystal form (see paper)
39% identity, 80% coverage: 5:233/288 of query aligns to 7:230/292 of 3fa3J
- active site: Y42 (= Y39), T44 (≠ S41), G45 (= G42), A46 (= A43), D57 (= D54), D85 (= D81), D87 (= D83), H112 (≠ Q108), E114 (= E110), R151 (= R153), E181 (= E183), N204 (= N207), T211 (= T214), S213 (≠ V216)
- binding manganese (ii) ion: D85 (= D81), D87 (= D83)
3fa4A Crystal structure of 2,3-dimethylmalate lyase, a pep mutase/isocitrate lyase superfamily member, triclinic crystal form (see paper)
38% identity, 80% coverage: 5:233/288 of query aligns to 8:232/284 of 3fa4A
- active site: Y43 (= Y39), T45 (≠ S41), G46 (= G42), A47 (= A43), D58 (= D54), D86 (= D81), D88 (= D83), H113 (≠ Q108), E115 (= E110), R153 (= R153), E183 (= E183), N206 (= N207), T213 (= T214), S215 (≠ V216)
- binding magnesium ion: D86 (= D81), D88 (= D83)
3m0kA Structure of oxaloacetate acetylhydrolase in complex with the product oxalate (see paper)
35% identity, 92% coverage: 15:280/288 of query aligns to 20:266/289 of 3m0kA
3b8iA Crystal structure of oxaloacetate decarboxylase from pseudomonas aeruginosa (pa4872) in complex with oxalate and mg2+. (see paper)
36% identity, 85% coverage: 10:253/288 of query aligns to 15:249/284 of 3b8iA
- active site: I44 (≠ Y39), G46 (≠ S41), G47 (= G42), S48 (≠ A43), D59 (= D54), D86 (= D81), D88 (= D83), T113 (≠ Q108), E115 (= E110), A121 (≠ K116), F123 (≠ C118), G124 (= G119), R157 (= R153), V186 (≠ E183), M206 (≠ L205)
- binding oxalate ion: S48 (≠ A43), D86 (= D81), H233 (≠ G235)
Q9HUU1 Oxaloacetate decarboxylase; EC 4.1.1.112 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
36% identity, 85% coverage: 10:253/288 of query aligns to 17:251/287 of Q9HUU1
- D88 (= D81) binding
- Y212 (≠ G211) mutation to F: 25-fold increase in substrate affinity and 23-fold decrease in activity.
- H235 (≠ G235) mutation to A: 2-fold increase in substrate affinity and 15-fold decrease in activity.; mutation to Q: No change in substrate affinity and 3-fold decrease in activity.
1pymA Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate (see paper)
27% identity, 99% coverage: 3:286/288 of query aligns to 4:287/291 of 1pymA
- active site: W40 (≠ Y39), S42 (= S41), G43 (= G42), L44 (≠ A43), D54 (= D54), D81 (= D81), D83 (= D83), C108 (≠ Q108), E110 (= E110), K116 (= K116), N118 (≠ C118), S119 (≠ G119), R155 (= R153), H186 (≠ E183), V211 (≠ N207)
- binding oxalate ion: W40 (≠ Y39), S42 (= S41), G43 (= G42), L44 (≠ A43), D81 (= D81), R155 (= R153)
1m1bA Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate (see paper)
27% identity, 99% coverage: 3:286/288 of query aligns to 4:287/291 of 1m1bA
- active site: W40 (≠ Y39), S42 (= S41), G43 (= G42), L44 (≠ A43), D54 (= D54), D81 (= D81), D83 (= D83), C108 (≠ Q108), E110 (= E110), K116 (= K116), N118 (≠ C118), S119 (≠ G119), R155 (= R153), H186 (≠ E183), V211 (≠ N207)
- binding magnesium ion: D81 (= D81), R155 (= R153)
- binding sulfopyruvate: S42 (= S41), G43 (= G42), L44 (≠ A43), D81 (= D81), N118 (≠ C118), S119 (≠ G119), L120 (≠ H120), R155 (= R153)
P56839 Phosphoenolpyruvate phosphomutase; PEP mutase; PEP phosphomutase; Phosphoenolpyruvate mutase; EC 5.4.2.9 from Mytilus edulis (Blue mussel) (see 2 papers)
27% identity, 99% coverage: 3:286/288 of query aligns to 8:291/295 of P56839
- D58 (= D54) mutation D->A,S: Abolishes enzyme activity.; mutation to N: Strongly reduces enzyme activity.
- D85 (= D81) mutation to A: Strongly reduces enzyme activity and increases KM.
- D87 (= D83) mutation to A: Strongly reduces enzyme activity.
- E114 (= E110) mutation to A: Strongly reduces enzyme activity.
- N122 (≠ C118) mutation N->A,D: Strongly reduces enzyme activity.
- R159 (= R153) mutation to A: Strongly reduces enzyme activity.
- H190 (≠ E183) mutation to A: Strongly reduces enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5uncA The crystal structure of phosphoenolpyruvate phosphomutase from streptomyces platensis subsp. Rosaceus
30% identity, 95% coverage: 13:286/288 of query aligns to 13:285/289 of 5uncA
- active site: W39 (≠ Y39), S41 (= S41), G42 (= G42), L43 (≠ A43), D53 (= D54), D80 (= D81), D82 (= D83), T107 (≠ Q108), E109 (= E110), K115 (= K116), N117 (≠ C118), S118 (≠ G119), R153 (= R153), H184 (≠ E183), V209 (≠ G211)
- binding alpha-D-xylopyranose: H22 (≠ Y22), N23 (≠ D23), G26 (≠ S26), L29 (≠ V29), G239 (≠ I240), V243 (≠ M244)
Query Sequence
>RR42_RS22175 FitnessBrowser__Cup4G11:RR42_RS22175
MTTPSLADRLCQPRVLLVPGVYDAFSALVAAQAGFEALYLSGAAVAYTQLGRSDVGLTTA
TETVDIVGRITDRVDLPLIVDADTGYGNALNVIRTVRTLERAGAAMIQLEDQTFPKRCGH
LDNKRVVTPAEMCGKLKAALDARASSRTLILARTDAVAIEGLDAAIERAEAYVACGVDAL
FIEALRTEQDMARVCAHFAGRVPLLANMVEGGKTPVQSAAELAGRGFRIVIFPGGVVRFI
GAQMKRYYSSLLEHGTTAPMRDAMLDFDGLNGVIGTPELIAQGQRYGE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory