SitesBLAST
Comparing RR42_RS22445 FitnessBrowser__Cup4G11:RR42_RS22445 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P56839 Phosphoenolpyruvate phosphomutase; PEP mutase; PEP phosphomutase; Phosphoenolpyruvate mutase; EC 5.4.2.9 from Mytilus edulis (Blue mussel) (see 2 papers)
66% identity, 51% coverage: 9:298/568 of query aligns to 3:292/295 of P56839
- D58 (= D64) mutation D->A,S: Abolishes enzyme activity.; mutation to N: Strongly reduces enzyme activity.
- D85 (= D91) mutation to A: Strongly reduces enzyme activity and increases KM.
- D87 (= D93) mutation to A: Strongly reduces enzyme activity.
- E114 (= E120) mutation to A: Strongly reduces enzyme activity.
- N122 (= N128) mutation N->A,D: Strongly reduces enzyme activity.
- R159 (= R165) mutation to A: Strongly reduces enzyme activity.
- H190 (= H196) mutation to A: Strongly reduces enzyme activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pymA Phosphoenolpyruvate mutase from mollusk in with bound mg2-oxalate (see paper)
67% identity, 50% coverage: 13:298/568 of query aligns to 3:288/291 of 1pymA
- active site: W40 (= W50), S42 (= S52), G43 (= G53), L44 (= L54), D54 (= D64), D81 (= D91), D83 (= D93), C108 (= C118), E110 (= E120), K116 (= K126), N118 (= N128), S119 (= S129), R155 (= R165), H186 (= H196), V211 (= V221)
- binding oxalate ion: W40 (= W50), S42 (= S52), G43 (= G53), L44 (= L54), D81 (= D91), R155 (= R165)
1m1bA Crystal structure of phosphoenolpyruvate mutase complexed with sulfopyruvate (see paper)
67% identity, 50% coverage: 13:298/568 of query aligns to 3:288/291 of 1m1bA
- active site: W40 (= W50), S42 (= S52), G43 (= G53), L44 (= L54), D54 (= D64), D81 (= D91), D83 (= D93), C108 (= C118), E110 (= E120), K116 (= K126), N118 (= N128), S119 (= S129), R155 (= R165), H186 (= H196), V211 (= V221)
- binding magnesium ion: D81 (= D91), R155 (= R165)
- binding sulfopyruvate: S42 (= S52), G43 (= G53), L44 (= L54), D81 (= D91), N118 (= N128), S119 (= S129), L120 (≠ F130), R155 (= R165)
5uncA The crystal structure of phosphoenolpyruvate phosphomutase from streptomyces platensis subsp. Rosaceus
45% identity, 51% coverage: 14:300/568 of query aligns to 3:288/289 of 5uncA
- active site: W39 (= W50), S41 (= S52), G42 (= G53), L43 (= L54), D53 (= D64), D80 (= D91), D82 (= D93), T107 (≠ C118), E109 (= E120), K115 (= K126), N117 (= N128), S118 (= S129), R153 (= R165), H184 (= H196), V209 (= V221)
- binding alpha-D-xylopyranose: H22 (= H33), N23 (= N34), G26 (≠ S37), L29 (≠ I40), G239 (≠ A251), V243 (≠ M255)
Q84G06 Phosphonopyruvate hydrolase; PPH; EC 3.11.1.3 from Variovorax sp. (strain Pal2) (see paper)
41% identity, 51% coverage: 12:298/568 of query aligns to 2:289/290 of Q84G06
- D81 (= D91) binding
- R188 (≠ K198) mutation to A: Reduced affinity for substrate.
2hjpA Crystal structure of phosphonopyruvate hydrolase complex with phosphonopyruvate and mg++ (see paper)
40% identity, 51% coverage: 12:298/568 of query aligns to 2:282/283 of 2hjpA
- active site: W40 (= W50), S42 (= S52), G43 (= G53), F44 (≠ L54), D54 (= D64), D81 (= D91), D83 (= D93), V108 (≠ C118), E110 (= E120), K116 (= K126), T118 (≠ R135), R148 (= R165), H179 (= H196), V204 (= V221)
- binding phosphonopyruvate: W40 (= W50), S42 (= S52), F44 (≠ L54), D81 (= D91), R148 (= R165), H179 (= H196), R181 (≠ K198)
- binding alpha-D-xylopyranose: E32 (≠ R42), S75 (≠ D85)
2duaA Crystal structure of phosphonopyruvate hydrolase complex with oxalate and mg++ (see paper)
40% identity, 51% coverage: 12:298/568 of query aligns to 2:282/283 of 2duaA
- active site: W40 (= W50), S42 (= S52), G43 (= G53), F44 (≠ L54), D54 (= D64), D81 (= D91), D83 (= D93), V108 (≠ C118), E110 (= E120), K116 (= K126), T118 (≠ R135), R148 (= R165), H179 (= H196), V204 (= V221)
- binding oxalate ion: W40 (= W50), S42 (= S52), F44 (≠ L54), D81 (= D91), R148 (= R165)
- binding alpha-D-xylopyranose: E32 (≠ R42), S75 (≠ D85)
P96074 Fosfomycin biosynthesis bifunctional protein Fom1; EC 2.7.7.104; EC 5.4.2.9 from Streptomyces wedmorensis (see paper)
34% identity, 44% coverage: 29:280/568 of query aligns to 162:432/435 of P96074
Sites not aligning to the query:
- 11:12 binding
- 45:46 binding
- 77 binding
- 91:94 binding
- 100 binding
- 124:127 binding
4iqdA Crystal structure of carboxyvinyl-carboxyphosphonate phosphorylmutase from bacillus anthracis
33% identity, 49% coverage: 16:292/568 of query aligns to 12:286/290 of 4iqdA
- active site: Y46 (≠ W50), S48 (= S52), G49 (= G53), A50 (≠ L54), D60 (= D64), D87 (= D91), D89 (= D93), Q114 (≠ C118), E116 (= E120), K122 (= K126), C124 (≠ N128), G125 (≠ S129), H126 (≠ F130), R157 (= R165), E187 (≠ H196), N209 (≠ V221)
- binding pyruvic acid: E71 (≠ D75), R72 (≠ T76), D75 (≠ F79), G165 (= G174), L166 (≠ M175), Y218 (vs. gap), Y219 (vs. gap)
P77541 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 46% coverage: 34:296/568 of query aligns to 27:286/296 of P77541
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1mumA Structure of the 2-methylisocitrate lyase (prpb) from escherichia coli (see paper)
28% identity, 46% coverage: 34:296/568 of query aligns to 25:284/289 of 1mumA
- active site: Y41 (≠ W50), S43 (= S52), G44 (= G53), G45 (≠ L54), D56 (= D64), D83 (= D91), D85 (= D93), H111 (≠ C118), E113 (= E120), K119 (= K126), C121 (≠ N128), G122 (= G133), H123 (≠ E134), R156 (= R165), E186 (≠ D203), N208 (≠ V221), T215 (= T228), L217 (vs. gap)
- binding magnesium ion: D56 (= D64), D85 (= D93)
Q56062 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
29% identity, 47% coverage: 32:296/568 of query aligns to 25:286/295 of Q56062
- SGG 45:47 (≠ SGL 52:54) binding
- D58 (= D64) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- D85 (= D91) binding
- K121 (= K126) mutation to A: 1000-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R122 (≠ T127) mutation to K: 2-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- C123 (≠ N128) mutation to A: Inactive. Retains the same oligomeric state of the wild-type.
- H125 (≠ E134) mutation to A: 750-fold decrease in the catalytic efficiency. Retains the same oligomeric state of the wild-type.
- R158 (= R165) binding
6t4vC Crystal structure of 2-methylisocitrate lyase (prpb) from pseudomonas aeruginosa in apo form.
31% identity, 44% coverage: 34:282/568 of query aligns to 25:261/277 of 6t4vC
- active site: Y41 (≠ W50), S43 (= S52), G44 (= G53), G45 (≠ L54), D56 (= D64), D83 (= D91), D85 (= D93), H111 (≠ C118), E113 (= E120), R145 (= R165), E175 (≠ D203), N197 (≠ V221), T204 (= T228), L206 (vs. gap)
- binding pyruvic acid: F88 (≠ Y96), N94 (= N101)
1o5qA Crystal structure of pyruvate and mg2+ bound 2-methylisocitrate lyase (prpb) from salmonella typhimurium (see paper)
28% identity, 47% coverage: 32:296/568 of query aligns to 21:271/271 of 1o5qA
- active site: Y39 (≠ W50), S41 (= S52), G42 (= G53), G43 (≠ L54), D54 (= D64), D81 (= D91), D83 (= D93), H109 (≠ C118), E111 (= E120), R143 (= R165), E173 (≠ D203), N195 (≠ V221), T202 (= T228), L204 (vs. gap)
- binding pyruvic acid: Y39 (≠ W50), S41 (= S52), G43 (≠ L54), D81 (= D91), R143 (= R165)
Q05957 Petal death protein; (R)-2-methylmalate lyase; D-citramalate lyase; Oxalacetic hydrolase; PSR132; EC 3.7.1.1; EC 4.1.3.- from Dianthus caryophyllus (Carnation) (Clove pink) (see 2 papers)
29% identity, 48% coverage: 10:284/568 of query aligns to 24:297/318 of Q05957
- D79 (= D64) mutation to A: Reduces catalytic efficiency 1000-fold.
- D107 (= D91) binding
- D109 (= D93) binding
- K142 (= K126) binding
- C144 (≠ N128) mutation to A: Loss of catalytic activity.
Sites not aligning to the query:
- 1:3 modified: propeptide, Removed in mature form
1zlpA Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
29% identity, 48% coverage: 28:297/568 of query aligns to 15:283/284 of 1zlpA
- active site: F37 (≠ W50), S39 (= S52), G40 (= G53), Y41 (≠ L54), D52 (= D64), D80 (= D91), D82 (= D93), F107 (≠ C118), E109 (= E120), K115 (= K126), C117 (≠ N128), G118 (≠ S129), H119 (≠ F130), R152 (= R165), E182 (≠ H196), N204 (≠ L218), T211 (≠ Y225), L213 (≠ S227)
- binding 5-hydroxypentanal: C117 (≠ N128), G118 (≠ S129), R152 (= R165), I206 (= I220)
- binding magnesium ion: D80 (= D91), K115 (= K126)
1zlpB Petal death protein psr132 with cysteine-linked glutaraldehyde forming a thiohemiacetal adduct (see paper)
29% identity, 48% coverage: 28:297/568 of query aligns to 15:283/285 of 1zlpB
- active site: F37 (≠ W50), S39 (= S52), G40 (= G53), Y41 (≠ L54), D52 (= D64), D80 (= D91), D82 (= D93), F107 (≠ C118), E109 (= E120), K115 (= K126), C117 (≠ N128), G118 (≠ S129), H119 (≠ F130), R152 (= R165), E182 (≠ H196), N204 (≠ L218), T211 (≠ Y225), L213 (≠ S227)
- binding 5-hydroxypentanal: Y41 (≠ L54), C117 (≠ N128), R152 (= R165), I206 (= I220)
1jylA Catalytic mechanism of ctp:phosphocholine cytidylyltransferase from streptococcus pneumoniae (licc) (see paper)
37% identity, 21% coverage: 307:423/568 of query aligns to 5:124/228 of 1jylA
Sites not aligning to the query:
3b8iA Crystal structure of oxaloacetate decarboxylase from pseudomonas aeruginosa (pa4872) in complex with oxalate and mg2+. (see paper)
30% identity, 32% coverage: 15:195/568 of query aligns to 9:185/284 of 3b8iA
- active site: I44 (≠ W50), G46 (≠ S52), G47 (= G53), S48 (≠ L54), D59 (= D64), D86 (= D91), D88 (= D93), T113 (≠ C118), E115 (= E120), A121 (≠ K126), F123 (≠ I131), G124 (≠ D132), R157 (= R165)
- binding oxalate ion: S48 (≠ L54), D86 (= D91)
Sites not aligning to the query:
Q9HUU1 Oxaloacetate decarboxylase; EC 4.1.1.112 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
32% identity, 28% coverage: 36:195/568 of query aligns to 32:187/287 of Q9HUU1
Sites not aligning to the query:
- 212 Y→F: 25-fold increase in substrate affinity and 23-fold decrease in activity.
- 235 H→A: 2-fold increase in substrate affinity and 15-fold decrease in activity.; H→Q: No change in substrate affinity and 3-fold decrease in activity.
Query Sequence
>RR42_RS22445 FitnessBrowser__Cup4G11:RR42_RS22445
MNAIDPIFSTASRSARLRQMIVGNELEFMMEAHNGLSARIVREAGFKAIWASGLAISAQY
GVRDNNEASWTQVVDTLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDDNFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILQFAREWAGRGPLVIVPTKYYSTPTEAFRKAGISV
VIWANHLIRVAASSMQAVAKEIHDSETLVNVEDRIATVNEIFRLQDADEYSTAEKIYLSG
SQAPGAAVVLAAGRGTGLEPLTEDRPKVMLPVAGKPLLRWLVDAFKKQSINDITVVGGYQ
AKAIDTAGIKLVVNEQYAQTGELASLACAVDGLQTDTVIAYGDLLFRSYILRDLLESDAP
FSVVVDSSLTTESNQSVRDFAYCSAPDDRDLFGQKILLRHVSSKGQEPGAGQAQAPHGRW
IGLLNVRGEGRVRLQKLVAELRKRDDFNTLDMPALLNALVEAGEQIEVKYVHGHWRGVND
LDDFRRAGDFAHTQTPFAVGGTDAEEAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory