SitesBLAST
Comparing RR42_RS22745 FitnessBrowser__Cup4G11:RR42_RS22745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P33221 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; GAR transformylase T; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Escherichia coli (strain K12) (see 5 papers)
59% identity, 99% coverage: 1:381/386 of query aligns to 16:389/392 of P33221
- EL 22:23 (= EL 7:8) binding
- E82 (= E67) binding
- R114 (= R100) binding
- K155 (= K142) binding
- SSGKGQ 160:165 (= SSGKGQ 147:152) binding
- G162 (= G149) mutation to I: Strong decrease in the reaction rate for the conversion of formate to FGAR and in the affinity for formate. 3- and 2-fold decrease in the affinity for ATP and GAR, respectively.
- K179 (≠ D166) modified: N6-acetyllysine
- EGVV 195:198 (≠ EGFI 182:185) binding
- E203 (= E190) binding
- E267 (= E259) binding
- E279 (= E271) binding
- D286 (= D278) binding
- K355 (= K347) binding
- RR 362:363 (= RR 354:355) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1kjiA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-amppcp (see paper)
59% identity, 99% coverage: 1:381/386 of query aligns to 15:386/389 of 1kjiA
- active site: E114 (= E101), K154 (= K142), S159 (= S147), G161 (= G149), E264 (= E259), E276 (= E271), D283 (= D278), T284 (= T279), R360 (= R355)
- binding phosphomethylphosphonic acid adenylate ester: R113 (= R100), I152 (≠ V140), K154 (= K142), S159 (= S147), S160 (= S148), G161 (= G149), Q164 (= Q152), E192 (= E182), V195 (≠ I185), E200 (= E190), Q222 (= Q217), E264 (= E259), F266 (= F261), E276 (= E271)
- binding magnesium ion: E264 (= E259), E276 (= E271)
1ez1A Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar (see paper)
59% identity, 99% coverage: 1:381/386 of query aligns to 15:386/389 of 1ez1A
- active site: E114 (= E101), K154 (= K142), S159 (= S147), G161 (= G149), E264 (= E259), E276 (= E271), D283 (= D278), T284 (= T279), R360 (= R355)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R100), I152 (≠ V140), K154 (= K142), S159 (= S147), S160 (= S148), G161 (= G149), E192 (= E182), V194 (≠ F184), V195 (≠ I185), F197 (= F187), E200 (= E190), Q222 (= Q217), E264 (= E259), F266 (= F261), E276 (= E271)
- binding glycinamide ribonucleotide: G20 (= G6), E21 (= E7), L22 (= L8), E81 (= E67), I82 (= I68), S160 (= S148), D283 (= D278), K352 (= K347), R359 (= R354), R360 (= R355)
- binding magnesium ion: E264 (= E259), E276 (= E271)
1eyzA Structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp (see paper)
59% identity, 99% coverage: 1:381/386 of query aligns to 15:386/389 of 1eyzA
- active site: E114 (= E101), K154 (= K142), S159 (= S147), G161 (= G149), E264 (= E259), E276 (= E271), D283 (= D278), T284 (= T279), R360 (= R355)
- binding phosphoaminophosphonic acid-adenylate ester: R113 (= R100), I152 (≠ V140), K154 (= K142), S159 (= S147), S160 (= S148), G161 (= G149), Q164 (= Q152), E192 (= E182), V195 (≠ I185), F197 (= F187), E200 (= E190), E264 (= E259), F266 (= F261), E276 (= E271)
- binding magnesium ion: E264 (= E259), E276 (= E271)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
58% identity, 99% coverage: 1:381/386 of query aligns to 15:383/386 of 1kjjA
- active site: E114 (= E101), K154 (= K142), S159 (= S147), G161 (= G149), E261 (= E259), E273 (= E271), D280 (= D278), T281 (= T279), R357 (= R355)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R100), I152 (≠ V140), K154 (= K142), S159 (= S147), S160 (= S148), G161 (= G149), Q164 (= Q152), E189 (= E182), V192 (≠ I185), E197 (= E190), Q219 (= Q217), E261 (= E259), F263 (= F261), E273 (= E271)
- binding magnesium ion: E261 (= E259), E273 (= E271)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
58% identity, 99% coverage: 1:381/386 of query aligns to 15:383/386 of 1kj8A
- active site: E114 (= E101), K154 (= K142), S159 (= S147), G161 (= G149), E261 (= E259), E273 (= E271), D280 (= D278), T281 (= T279), R357 (= R355)
- binding adenosine-5'-triphosphate: R113 (= R100), I152 (≠ V140), K154 (= K142), S159 (= S147), S160 (= S148), G161 (= G149), Q164 (= Q152), E189 (= E182), V192 (≠ I185), F194 (= F187), E197 (= E190), Q219 (= Q217), G222 (= G220), E261 (= E259), F263 (= F261), E273 (= E271)
- binding glycinamide ribonucleotide: G20 (= G6), E21 (= E7), L22 (= L8), E81 (= E67), I82 (= I68), S160 (= S148), D280 (= D278), K349 (= K347), R356 (= R354)
- binding magnesium ion: E261 (= E259), E273 (= E271)
1kjqA Crystal structure of glycinamide ribonucleotide transformylase in complex with mg-adp (see paper)
58% identity, 99% coverage: 1:381/386 of query aligns to 15:385/388 of 1kjqA
- active site: E114 (= E101), K154 (= K142), E263 (= E259), E275 (= E271), D282 (= D278), T283 (= T279), R359 (= R355)
- binding adenosine-5'-diphosphate: R113 (= R100), I152 (≠ V140), K154 (= K142), E191 (= E182), V193 (≠ F184), V194 (≠ I185), F196 (= F187), E199 (= E190), Q221 (= Q217), F265 (= F261), E275 (= E271)
- binding magnesium ion: E263 (= E259), E275 (= E271)
O58056 Formate-dependent phosphoribosylglycinamide formyltransferase; 5'-phosphoribosylglycinamide transformylase 2; Formate-dependent GAR transformylase; GAR transformylase 2; GART 2; Non-folate glycinamide ribonucleotide transformylase; Phosphoribosylglycinamide formyltransferase 2; EC 6.3.1.21 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
47% identity, 99% coverage: 1:383/386 of query aligns to 20:411/430 of O58056
2dwcB Crystal structure of probable phosphoribosylglycinamide formyl transferase from pyrococcus horikoshii ot3 complexed with adp
45% identity, 99% coverage: 1:383/386 of query aligns to 22:400/409 of 2dwcB
- active site: E265 (= E259), E277 (= E271), D284 (= D278), T285 (= T279), R372 (= R355)
- binding adenosine-5'-diphosphate: R120 (= R100), H159 (≠ V140), K161 (= K142), H190 (≠ F184), I191 (= I185), F193 (= F187), E196 (= E190), F267 (= F261), E277 (= E271)
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
28% identity, 78% coverage: 2:302/386 of query aligns to 5:290/373 of 4mamA
- active site: Y144 (≠ S147), G146 (= G149), E247 (= E259), E259 (= E271), N266 (≠ D278), S267 (≠ T279)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R100), I136 (≠ V140), K138 (= K142), Y144 (≠ S147), G146 (= G149), Q149 (= Q152), E175 (= E182), F177 (= F184), V178 (≠ I185), F180 (= F187), E183 (= E190), H206 (≠ Q217), F249 (= F261), E259 (= E271)
Sites not aligning to the query:
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
28% identity, 78% coverage: 2:302/386 of query aligns to 5:290/365 of 5jqwA
- active site: Y144 (≠ S147), G146 (= G149), E247 (= E259), E259 (= E271), N266 (≠ D278), S267 (≠ T279)
- binding adenosine-5'-diphosphate: R98 (= R100), K138 (= K142), G143 (≠ S146), Y144 (≠ S147), D145 (≠ S148), G146 (= G149), V178 (≠ I185), E183 (= E190), H206 (≠ Q217), F249 (= F261), E259 (= E271)
Sites not aligning to the query:
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
28% identity, 78% coverage: 2:302/386 of query aligns to 5:290/366 of 4ma0A
- active site: Y144 (≠ S147), G146 (= G149), E247 (= E259), E259 (= E271), N266 (≠ D278), S267 (≠ T279)
- binding adenosine monophosphate: I136 (≠ V140), K138 (= K142), E175 (= E182), A176 (≠ G183), F177 (= F184), V178 (≠ I185), E183 (= E190), H206 (≠ Q217), F249 (= F261), E259 (= E271)
Sites not aligning to the query:
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
27% identity, 95% coverage: 7:374/386 of query aligns to 18:367/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (≠ E101), K147 (= K142), Q158 (= Q152), W184 (≠ F184), V185 (≠ I185), F187 (= F187), E190 (= E190), N216 (≠ G220), F257 (= F261), N267 (≠ S270), E268 (= E271)
- binding 5-aminoimidazole ribonucleotide: Q18 (≠ E7), L19 (= L8), E76 (= E67), Y153 (vs. gap), R272 (= R275), K340 (= K347), R347 (= R354)
Sites not aligning to the query:
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
27% identity, 95% coverage: 7:374/386 of query aligns to 17:366/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (≠ E101), K146 (= K142), Y152 (vs. gap), G154 (= G149), Q157 (= Q152), W183 (≠ F184), V184 (≠ I185), E189 (= E190), N215 (≠ G220), F256 (= F261), N266 (≠ S270), E267 (= E271)
- binding carbonate ion: R271 (= R275), H273 (= H277), N274 (≠ D278)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
27% identity, 95% coverage: 7:374/386 of query aligns to 19:368/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (≠ E101), K148 (= K142), Y154 (vs. gap), D155 (≠ S148), G156 (= G149), Q159 (= Q152), E183 (= E182), W185 (≠ F184), V186 (≠ I185), F188 (= F187), E191 (= E190), H214 (≠ Q217), N217 (≠ G220), E256 (= E259), F258 (= F261), E269 (= E271)
- binding carbonate ion: R273 (= R275), H275 (= H277), N276 (≠ D278)
- binding magnesium ion: T105 (≠ M98), E111 (≠ R104), E256 (= E259), E269 (= E271), L270 (≠ V272)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
27% identity, 95% coverage: 7:374/386 of query aligns to 18:367/377 of 3q2oB
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
27% identity, 95% coverage: 7:374/386 of query aligns to 18:367/380 of 4dlkA
- active site: Y153 (vs. gap), G155 (= G149), E255 (= E259), E268 (= E271), N275 (≠ D278), S276 (≠ T279), K348 (≠ R355)
- binding adenosine-5'-triphosphate: E76 (= E67), F77 (≠ I68), R107 (≠ E101), K147 (= K142), Y153 (vs. gap), D154 (≠ S148), G155 (= G149), Q158 (= Q152), W184 (≠ F184), V185 (≠ I185), F187 (= F187), E190 (= E190), E255 (= E259), F257 (= F261), N267 (≠ S270), E268 (= E271), R272 (= R275), H274 (= H277), N275 (≠ D278), K340 (= K347), R347 (= R354), K348 (≠ R355)
- binding calcium ion: E255 (= E259), E268 (= E271)
- binding phosphate ion: Q47 (= Q36), A49 (= A38)
4ma5A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an atp analog, amp-pnp.
27% identity, 78% coverage: 2:302/386 of query aligns to 5:288/363 of 4ma5A
- active site: Y144 (≠ S147), G146 (= G149), E247 (= E259), E257 (= E271), N264 (≠ D278), S265 (≠ T279)
- binding phosphoaminophosphonic acid-adenylate ester: I136 (≠ V140), K138 (= K142), D145 (≠ S148), G146 (= G149), F177 (= F184), V178 (≠ I185), E183 (= E190), H206 (≠ Q217), E247 (= E259), F249 (= F261), N256 (≠ S270), E257 (= E271), H263 (= H277)
Sites not aligning to the query:
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
25% identity, 95% coverage: 17:381/386 of query aligns to 21:356/360 of 3ax6A
- active site: E231 (= E259), E244 (= E271), N251 (≠ D278), S252 (≠ T279), K330 (≠ R355)
- binding adenosine-5'-diphosphate: K101 (≠ R100), V136 (= V140), K138 (= K142), E164 (= E182), F166 (= F184), V167 (≠ I185), E172 (= E190), F233 (= F261), N243 (≠ S270)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
32% identity, 67% coverage: 58:317/386 of query aligns to 57:297/360 of 3aw8A
- active site: E240 (= E259), E252 (= E271), N259 (≠ D278), S260 (≠ T279)
- binding adenosine monophosphate: L135 (≠ V140), K137 (= K142), Q142 (= Q152), F168 (= F184), V169 (≠ I185), E174 (= E190), H197 (≠ Q217), F242 (= F261), E252 (= E271)
Sites not aligning to the query:
Query Sequence
>RR42_RS22745 FitnessBrowser__Cup4G11:RR42_RS22745
MLLGSGELGKEVLIALQRLGVETIAVDRYADAPGQQVAHHARTISMSDPDQLKALIEAEK
PDLVVPEIEAIATQMLETLEAAGVVRVIPTARAARLTMDREGIRRLAAETLGVPTSPYKF
CDSLEELQAAIDGGIGYPCVVKPVMSSSGKGQSKIDGPADVKAAWDYAMAGGRVSHGRVI
VEGFIDFDYEITLLTVRAIGADGQVETQFCEPIGHVQVSGDYVESWQPHPMHPAALQKSQ
QIAQAVTANLGGQGLFGVELFVKGEQVWFSEVSPRPHDTGMVTMITQWQNEFELHARAIL
GLPVSTALKSPGASAVIYGGVDAKGVVFDGVDEALRVPQTELRLFGKPESFTKRRMGVAL
AYDADVEAARVRAKDAAGRVKPRVAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory