Comparing RR42_RS22775 FitnessBrowser__Cup4G11:RR42_RS22775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 98% coverage: 4:207/208 of query aligns to 540:741/758 of O14289
Sites not aligning to the query:
P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 92% coverage: 1:191/208 of query aligns to 1:186/198 of P9WK95
Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 61% coverage: 18:143/208 of query aligns to 13:120/170 of Q58667
2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
35% identity, 61% coverage: 18:143/208 of query aligns to 13:120/167 of 2pkpA
D9X0I3 Aconitate hydratase A; ACN; Aconitase; EC 4.2.1.3 from Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494) (see paper)
47% identity, 27% coverage: 66:122/208 of query aligns to 800:857/931 of D9X0I3
Sites not aligning to the query:
P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
41% identity, 31% coverage: 67:130/208 of query aligns to 763:828/889 of P21399
Sites not aligning to the query:
2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
41% identity, 31% coverage: 67:130/208 of query aligns to 762:827/888 of 2b3xA
Sites not aligning to the query:
3snpA Crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire RNA (see paper)
39% identity, 31% coverage: 67:130/208 of query aligns to 724:789/850 of 3snpA
Sites not aligning to the query:
Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 36% coverage: 45:119/208 of query aligns to 853:913/990 of Q9SIB9
Sites not aligning to the query:
A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 27% coverage: 67:123/208 of query aligns to 807:864/943 of A0QX20
Sites not aligning to the query:
>RR42_RS22775 FitnessBrowser__Cup4G11:RR42_RS22775
MQPFTVVTGAAVPLLRANVDTDVIIRIERLTALPREQLGPYALEALRYRADGSEDPGCVF
NQPAFRGAPVLLAGANFGCGSSREGAVWALMGLGVRCVIAPSYGDIFYNNCFQNGVLPIR
LPAEAVQALAAQCASGAPVRVDLASATLSAPDGATVAFPVDRLRREALLHGLDDIGLTLK
DDALIRAWQQADRTRRPWAWTVRRQDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory