SitesBLAST – Find functional sites

 

SitesBLAST

Comparing RR42_RS22775 FitnessBrowser__Cup4G11:RR42_RS22775 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 9 hits to proteins with known functional sites (download)

O14289 3-isopropylmalate dehydratase; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
47% identity, 98% coverage: 4:207/208 of query aligns to 540:741/758 of O14289

query
sites
O14289
F
 
F
T
 
T
V
 
V
V
 
V
T
 
E
G
 
G
A
 
I
A
 
A
V
 
A
P
 
P
L
 
L
L
 
P
R
 
M
A
 
A
N
 
N
V
 
V
D
 
D
T
 
T
D
 
D
V
 
K
I
 
I
I
 
I
R
 
P
I
 
K
E
 
Q
R
 
F
L
 
L
T
 
K
A
 
T
L
 
I
P
 
K
R
 
R
E
 
T
Q
 
G
L
 
L
G
 
G
P
 
Q
Y
 
F
A
 
A
L
 
F
E
 
Y
A
 
E
L
 
I
R
 
R
Y
 
Y
R
 
D
A
 
A
D
 
D
G
 
G
S
 
K
E
 
E
D
 
I
P
 
P
G
 
D
C
 
F
V
 
V
F
 
L
N
 
N
Q
 
R
P
 
E
A
 
P
F
 
Y
R
 
R
G
 
H
A
 
A
P
 
T
V
 
V
L
 
L
L
 
V
A
 
A
G
 
H
A
 
D
N
 
N
F
 
F
G
 
G
C
 
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
G
 
H
A
 
A
V
 
P
W
 
W
A
 
A
L
 
L
M
 
N
G
 
D
L
 
F
G
 
G
V
 
I
R
 
R
C
 
V
V
 
I
I
 
I
A
 
A
P
 
P
S
 
S
Y
 
F
G
 
A
D
 
D
I
 
I
F
 
F
Y
 
F
N
 
N
N
 
N
C
 
C
F
 
F
Q
 
K
N
 
N
G
 
G
V
 
M
L
 
L
P
 
P
I
 
I
R
 
P
L
 
T
P
 
P
A
 
I
E
 
E
A
 
Q
V
 
V
Q
 
N
A
 
D
L
 
M
A
 
M
A
 
K
Q
 
A
C
 
A
A
 
E
S
 
N
G
 
Q
A
 
V
P
 
K
V
 
F
R
 
S
V
 
V
D
 
D
L
 
L
A
 
V
S
 
N
A
 
Q
T
 
T
L
 
I
S
 
T
A
 
Y
P
 
G
D
 
D
G
 
-
A
 
K
T
 
Q
V
 
V
A
 
K
F
 
F
P
 
D
V
 
V
D
 
E
R
 
P
L
 
F
R
 
R
R
 
K
E
 
H
A
 
C
L
 
L
L
 
V
H
 
N
G
 
G
L
 
L
D
 
D
D
 
D
I
 
I
G
 
G
L
 
L
T
 
T
L
 
L
K
 
Q
D
 
K
D
 
E
A
 
T
L
 
M
I
 
I
R
 
D
A
 
A
W
 
F
Q
 
E
Q
 
A
A
 
A
D
 
R
R
 
E
T
 
E
R
 
N
R
 
F
P
 
P
W
 
W
A
 
M
W
 
-
T
 
N
V
 
I
R
 
K
R
 
R
Q
 
S
D
 
R
A
 
A

Sites not aligning to the query:

P9WK95 3-isopropylmalate dehydratase small subunit; Alpha-IPM isomerase; IPMI; Isopropylmalate isomerase; EC 4.2.1.33 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 92% coverage: 1:191/208 of query aligns to 1:186/198 of P9WK95

query
sites
P9WK95
M
 
M
Q
 
E
P
 
A
F
 
F
T
 
H
V
 
T
V
 
H
T
 
S
G
 
G
A
 
I
A
 
G
V
 
V
P
 
P
L
 
L
L
 
R
R
 
R
A
 
S
N
 
N
V
 
V
D
 
D
T
 
T
D
 
D
V
 
Q
I
 
I
I
 
I
R
 
P
I
 
A
E
 
V
R
 
F
L
 
L
T
 
K
A
 
R
L
 
V
P
 
T
R
 
R
E
 
T
Q
 
G
L
 
F
G
 
E
P
 
D
Y
 
G
A
 
L
L
 
F
E
 
A
A
 
G
L
 
W
R
 
R
Y
 
-
R
 
-
A
 
-
D
 
-
G
 
-
S
 
-
E
 
S
D
 
D
P
 
P
G
 
A
C
 
F
V
 
V
F
 
L
N
 
N
Q
 
L
P
 
S
A
 
P
F
 
F
R
 
D
G
 
R
A
 
G
P
 
S
V
 
V
L
 
L
L
 
V
A
 
A
G
 
G
A
 
P
N
 
D
F
 
F
G
 
G
C
 
T
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
G
 
H
A
 
A
V
 
V
W
 
W
A
 
A
L
 
L
M
 
M
G
 
D
L
 
Y
G
 
G
V
 
F
R
 
R
C
 
V
V
 
V
I
 
I
A
 
S
P
 
S
S
 
R
Y
 
F
G
 
G
D
 
D
I
 
I
F
 
F
Y
 
R
N
 
G
N
 
N
C
 
A
F
 
G
Q
 
K
N
 
A
G
 
G
V
 
L
L
 
L
P
 
A
I
 
A
R
 
E
L
 
V
P
 
A
A
 
Q
E
 
D
A
 
D
V
 
V
Q
 
E
A
 
L
L
 
L
-
 
W
-
 
K
A
 
L
A
 
I
Q
 
E
C
 
Q
A
 
S
S
 
P
G
 
G
A
 
L
P
 
E
V
 
I
R
 
T
V
 
A
D
 
N
L
 
L
A
 
Q
S
 
D
A
 
R
T
 
I
L
 
I
S
 
T
A
 
A
P
 
-
D
 
-
G
 
-
A
 
A
T
 
T
V
 
V
A
 
V
F
 
L
P
 
P
-
 
F
-
x
K
V
 
I
D
 
D
R
 
D
L
 
H
R
 
S
R
 
A
E
 
W
A
 
R
L
 
L
L
 
L
H
 
E
G
 
G
L
 
L
D
 
D
D
 
D
I
 
I
G
 
A
L
 
L
T
 
T
L
 
L
K
 
R
D
 
K
D
 
L
A
 
D
L
 
E
I
 
I
R
 
E
A
 
A
W
 
F
Q
 
E
Q
 
G
A
 
A

Q58667 Methanogen homoaconitase small subunit; HACN; Homoaconitate hydratase; EC 4.2.1.114 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
35% identity, 61% coverage: 18:143/208 of query aligns to 13:120/170 of Q58667

query
sites
Q58667
N
 
D
V
 
V
D
 
D
T
 
T
D
 
D
V
 
A
I
 
I
I
 
I
R
 
P
I
 
-
E
 
-
R
 
-
L
 
-
T
 
-
A
 
-
L
 
-
P
 
-
R
 
-
E
 
-
Q
 
-
L
 
-
G
 
G
P
 
P
Y
 
Y
A
 
L
L
x
R
E
x
T
A
 
T
L
 
D
R
 
P
Y
 
Y
R
 
E
A
 
L
D
 
A
G
 
S
S
 
H
E
 
C
D
 
M
P
 
A
G
 
G
C
 
I
V
 
D
F
 
E
N
 
N
Q
 
F
P
 
P
A
 
K
-
 
K
F
 
V
R
 
K
G
 
E
A
 
G
P
 
D
V
 
V
L
 
I
L
 
V
A
 
A
G
 
G
A
 
E
N
 
N
F
 
F
G
 
G
C
 
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
G
 
Q
A
 
A
V
 
V
W
 
I
A
 
A
L
 
I
M
 
K
G
 
Y
L
 
C
G
 
G
V
 
I
R
 
K
C
 
A
V
 
V
I
 
I
A
 
A
P
 
K
S
 
S
Y
 
F
G
 
A
D
 
R
I
 
I
F
 
F
Y
 
Y
N
 
R
N
 
N
C
 
A
F
 
I
Q
 
N
N
 
V
G
 
G
V
 
L
L
 
I
P
 
P
I
 
I
R
 
I
L
 
A
P
 
N
A
 
T
E
 
D
A
 
E
V
 
I
Q
 
K
A
 
-
L
 
-
A
 
-
A
 
-
Q
 
-
C
 
-
A
 
-
S
 
D
G
 
G
A
 
D
P
 
I
V
 
V
R
 
E
V
 
I
D
 
D
L
 
L

2pkpA Crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) (see paper)
35% identity, 61% coverage: 18:143/208 of query aligns to 13:120/167 of 2pkpA

query
sites
2pkpA
N
x
D
V
 
V
D
 
D
T
 
T
D
 
D
V
 
A
I
 
I
I
 
I
R
 
P
I
 
-
E
 
-
R
 
-
L
 
-
T
 
-
A
 
-
L
 
-
P
 
-
R
 
-
E
 
-
Q
 
-
L
 
-
G
 
G
P
 
P
Y
 
Y
A
 
L
L
 
R
E
 
T
A
 
T
L
 
D
R
 
P
Y
 
Y
R
 
E
A
 
L
D
 
A
G
 
S
S
 
H
E
 
C
D
 
M
P
 
A
G
 
G
C
 
I
V
 
D
F
 
E
N
 
N
Q
 
F
P
 
P
A
 
K
-
 
K
F
 
V
R
 
K
G
 
E
A
 
G
P
 
D
V
 
V
L
 
I
L
 
V
A
 
A
G
 
G
A
 
E
N
 
N
F
 
F
G
 
G
C
|
C
G
 
G
S
 
S
S
 
S
R
 
R
E
 
E
G
 
Q
A
 
A
V
 
V
W
 
I
A
 
A
L
 
I
M
 
K
G
 
Y
L
 
C
G
 
G
V
 
I
R
 
K
C
 
A
V
 
V
I
 
I
A
 
A
P
 
K
S
 
S
Y
 
F
G
 
A
D
 
R
I
 
I
F
 
F
Y
 
Y
N
 
R
N
 
N
C
 
A
F
 
I
Q
 
N
N
 
V
G
 
G
V
 
L
L
 
I
P
 
P
I
 
I
R
 
I
L
 
A
P
 
N
A
 
T
E
 
D
A
 
E
V
 
I
Q
 
K
A
 
-
L
 
-
A
 
-
A
 
-
Q
 
-
C
 
-
A
 
-
S
 
D
G
 
G
A
 
D
P
 
I
V
 
V
R
 
E
V
 
I
D
 
D
L
 
L

P21399 Cytoplasmic aconitate hydratase; Aconitase; Citrate hydro-lyase; Ferritin repressor protein; Iron regulatory protein 1; IRP1; Iron-responsive element-binding protein 1; IRE-BP 1; EC 4.2.1.3 from Homo sapiens (Human) (see 2 papers)
41% identity, 31% coverage: 67:130/208 of query aligns to 763:828/889 of P21399

query
sites
P21399
G
 
G
A
 
L
P
 
P
-
 
L
V
 
I
L
 
V
L
 
L
A
 
A
G
 
G
A
 
K
N
 
E
F
 
Y
G
 
G
C
 
A
G
 
G
S
|
S
S
 
S
R
|
R
E
 
D
G
 
W
A
 
A
V
 
A
W
 
K
A
 
G
L
 
P
M
 
F
G
 
L
L
 
L
G
 
G
V
 
I
R
 
K
C
 
A
V
 
V
I
 
L
A
 
A
P
 
E
S
 
S
Y
 
Y
G
 
E
D
 
R
I
 
I
F
 
H
Y
 
R
N
 
S
N
 
N
C
 
L
F
 
V
Q
 
G
N
 
M
G
 
G
V
 
V
L
 
I
P
 
P
I
 
L
R
 
E
-
 
Y
L
 
L
P
 
P
A
 
G
E
 
E
A
 
N
V
 
A
Q
 
D
A
 
A
L
 
L
A
 
G

Sites not aligning to the query:

2b3xA Structure of an orthorhombic crystal form of human cytosolic aconitase (irp1) (see paper)
41% identity, 31% coverage: 67:130/208 of query aligns to 762:827/888 of 2b3xA

query
sites
2b3xA
G
 
G
A
 
L
P
 
P
-
 
L
V
 
I
L
 
V
L
 
L
A
 
A
G
 
G
A
 
K
N
 
E
F
 
Y
G
 
G
C
 
A
G
 
G
S
|
S
S
 
S
R
|
R
E
 
D
G
 
W
A
 
A
V
 
A
W
 
K
A
 
G
L
 
P
M
 
F
G
 
L
L
 
L
G
 
G
V
 
I
R
 
K
C
 
A
V
 
V
I
 
L
A
 
A
P
 
E
S
 
S
Y
 
Y
G
 
E
D
 
R
I
 
I
F
 
H
Y
 
R
N
 
S
N
 
N
C
 
L
F
 
V
Q
 
G
N
 
M
G
 
G
V
 
V
L
 
I
P
 
P
I
 
L
R
 
E
-
 
Y
L
 
L
P
 
P
A
 
G
E
 
E
A
 
N
V
 
A
Q
 
D
A
 
A
L
 
L
A
 
G

Sites not aligning to the query:

3snpA Crystal structure analysis of iron regulatory protein 1 in complex with ferritin h ire RNA (see paper)
39% identity, 31% coverage: 67:130/208 of query aligns to 724:789/850 of 3snpA

query
sites
3snpA
G
 
G
A
 
H
P
 
P
-
 
L
V
 
I
L
 
V
L
 
L
A
 
A
G
 
G
A
 
K
N
 
E
F
 
Y
G
 
G
C
 
S
G
 
G
S
|
S
S
 
S
R
|
R
E
 
D
G
 
W
A
 
A
V
 
A
W
 
K
A
 
G
L
 
P
M
 
F
G
 
L
L
 
L
G
 
G
V
 
I
R
 
K
C
 
A
V
 
V
I
 
L
A
 
A
P
 
E
S
 
S
Y
 
Y
G
 
E
D
 
R
I
 
I
F
 
H
Y
 
R
N
 
S
N
 
N
C
 
L
F
 
V
Q
 
G
N
 
M
G
 
G
V
 
V
L
 
I
P
 
P
I
 
L
R
 
E
-
 
Y
L
 
L
P
 
P
A
 
G
E
 
E
A
 
N
V
 
A
Q
 
D
A
 
S
L
 
L
A
 
G

Sites not aligning to the query:

Q9SIB9 Aconitate hydratase 3, mitochondrial; Aconitase 3; mACO1; Citrate hydro-lyase 3; EC 4.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 36% coverage: 45:119/208 of query aligns to 853:913/990 of Q9SIB9

query
sites
Q9SIB9
A
 
A
L
 
M
R
 
R
Y
 
Y
R
 
K
A
 
S
D
 
S
G
 
G
S
 
E
E
 
D
D
 
T
P
 
-
G
 
-
C
 
-
V
 
-
F
 
-
N
 
-
Q
 
-
P
 
-
A
 
-
F
 
-
R
 
-
G
 
-
A
 
-
P
 
-
V
 
I
L
 
I
L
 
L
A
 
A
G
 
G
A
 
A
N
 
E
F
 
Y
G
 
G
C
 
S
G
 
G
S
 
S
S
 
S
R
 
R
E
 
D
G
 
W
A
 
A
V
 
A
W
 
K
A
 
G
L
 
P
M
 
M
G
 
L
L
 
Q
G
 
G
V
 
V
R
 
K
C
 
A
V
 
V
I
 
I
A
 
A
P
 
K
S
 
S
Y
 
F
G
 
E
D
 
R
I
 
I
F
 
H
Y
 
R
N
 
S
N
 
N
C
 
L
F
 
V
Q
 
G
N
 
M
G
 
G
V
 
I
L
 
I
P
 
P
I
 
L

Sites not aligning to the query:

A0QX20 Aconitate hydratase A; ACN; Aconitase; (2R,3S)-2-methylisocitrate dehydratase; (2S,3R)-3-hydroxybutane-1,2,3-tricarboxylate dehydratase; Iron-responsive protein-like; IRP-like; Probable 2-methyl-cis-aconitate hydratase; RNA-binding protein; EC 4.2.1.3; EC 4.2.1.99 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
41% identity, 27% coverage: 67:123/208 of query aligns to 807:864/943 of A0QX20

query
sites
A0QX20
G
 
G
A
 
I
P
 
P
-
 
L
V
 
V
L
 
V
L
 
L
A
 
G
G
 
G
A
 
K
N
 
E
F
 
Y
G
 
G
C
 
S
G
 
G
S
 
S
S
 
S
R
 
R
E
 
D
G
 
W
A
 
A
V
 
A
W
 
K
A
 
G
L
 
T
M
 
V
G
 
L
L
 
L
G
 
G
V
 
V
R
 
K
C
 
A
V
 
V
I
 
I
A
 
T
P
 
E
S
 
S
Y
 
F
G
 
E
D
 
R
I
 
I
F
 
H
Y
 
R
N
 
S
N
 
N
C
 
L
F
 
I
Q
 
G
N
 
M
G
 
G
V
 
V
L
 
I
P
 
P
I
 
L
R
 
Q
L
 
F
P
 
P
A
 
A

Sites not aligning to the query:

Query Sequence

>RR42_RS22775 FitnessBrowser__Cup4G11:RR42_RS22775
MQPFTVVTGAAVPLLRANVDTDVIIRIERLTALPREQLGPYALEALRYRADGSEDPGCVF
NQPAFRGAPVLLAGANFGCGSSREGAVWALMGLGVRCVIAPSYGDIFYNNCFQNGVLPIR
LPAEAVQALAAQCASGAPVRVDLASATLSAPDGATVAFPVDRLRREALLHGLDDIGLTLK
DDALIRAWQQADRTRRPWAWTVRRQDAA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory