SitesBLAST
Comparing RR42_RS22865 FitnessBrowser__Cup4G11:RR42_RS22865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
70% identity, 99% coverage: 6:399/400 of query aligns to 5:396/396 of 3tqxA
- active site: N48 (= N50), H134 (= H136), D179 (= D181), S183 (= S185), D208 (= D210), H211 (= H213), K242 (= K244)
- binding pyridoxal-5'-phosphate: S108 (= S110), C109 (= C111), F110 (= F112), H134 (= H136), D208 (= D210), S210 (= S212), H211 (= H213), T239 (= T241), K242 (= K244), F271 (= F273), S272 (= S274), N273 (= N275)
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
68% identity, 100% coverage: 1:400/400 of query aligns to 4:401/401 of 1fc4A
- active site: N53 (= N50), H139 (= H136), D184 (= D181), S188 (= S185), D213 (= D210), H216 (= H213), K247 (= K244)
- binding 2-amino-3-ketobutyric acid: N53 (= N50), H139 (= H136), S188 (= S185), H216 (= H213), K247 (= K244), R371 (= R370)
- binding pyridoxal-5'-phosphate: S113 (= S110), C114 (= C111), F115 (= F112), H139 (= H136), S188 (= S185), D213 (= D210), S215 (= S212), H216 (= H213), T244 (= T241), K247 (= K244), F276 (= F273), S277 (= S274), N278 (= N275)
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
68% identity, 100% coverage: 1:400/400 of query aligns to 1:398/398 of P0AB77
- H136 (= H136) binding
- S185 (= S185) binding in other chain
- R368 (= R370) binding
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
63% identity, 95% coverage: 16:394/400 of query aligns to 18:394/400 of 7v58B
Q0P5L8 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 from Bos taurus (Bovine) (see paper)
58% identity, 98% coverage: 9:399/400 of query aligns to 31:418/419 of Q0P5L8
- K265 (= K244) modified: N6-(pyridoxal phosphate)lysine
Sites not aligning to the query:
- 1:21 modified: transit peptide, Mitochondrion
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
57% identity, 99% coverage: 5:399/400 of query aligns to 7:399/399 of 7bxsA
- binding n-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane]: S112 (= S110), A113 (≠ C111), F114 (= F112), H138 (= H136), S187 (= S185), D212 (= D210), C214 (≠ S212), H215 (= H213), T243 (= T241), F275 (= F273), S276 (= S274), N277 (= N275), R370 (= R370)
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
57% identity, 99% coverage: 5:399/400 of query aligns to 7:399/399 of 7bxrA
- binding (2S,3R)-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylamino]-3-oxidanyl-pentanoic acid: N52 (= N50), S112 (= S110), A113 (≠ C111), F114 (= F112), H138 (= H136), S187 (= S185), D212 (= D210), C214 (≠ S212), H215 (= H213), T243 (= T241), L274 (= L272), F275 (= F273), S276 (= S274), N277 (= N275), R370 (= R370)
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
57% identity, 99% coverage: 5:399/400 of query aligns to 7:399/399 of 7bxqA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-allothreonine: N52 (= N50), A113 (≠ C111), F114 (= F112), H138 (= H136), S187 (= S185), D212 (= D210), C214 (≠ S212), H215 (= H213), T243 (= T241), F275 (= F273), S276 (= S274), N277 (= N275), R370 (= R370)
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
44% identity, 98% coverage: 7:399/400 of query aligns to 10:397/398 of 7poaA
- binding pyridoxal-5'-phosphate: G113 (≠ C111), F114 (= F112), H138 (= H136), S140 (= S138), D210 (= D210), A212 (≠ S212), H213 (= H213), T242 (= T241), K245 (= K244), S274 (= S274), T275 (≠ N275)
P08680 5-aminolevulinate synthase, erythroid-specific, mitochondrial; ALAS-E; 5-aminolevulinic acid synthase 2; Delta-ALA synthase 2; Delta-aminolevulinate synthase 2; EC 2.3.1.37 from Mus musculus (Mouse) (see 2 papers)
39% identity, 87% coverage: 47:393/400 of query aligns to 194:544/587 of P08680
- K391 (= K244) modified: N6-(pyridoxal phosphate)lysine; mutation K->A,H: Abolishes enzyme activity.
Sites not aligning to the query:
- 1:49 modified: transit peptide, Mitochondrion
5qqrB Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1171217421
37% identity, 87% coverage: 47:393/400 of query aligns to 53:403/429 of 5qqrB
- binding pyridoxal-5'-phosphate: S116 (= S110), C117 (= C111), F118 (= F112), H144 (= H136), E187 (≠ D181), S191 (= S185), D216 (= D210), V218 (≠ S212), H219 (= H213), T247 (= T241), K250 (= K244), T279 (≠ S274), T280 (≠ N275)
Sites not aligning to the query:
6hrhA Structure of human erythroid-specific 5'-aminolevulinate synthase, alas2
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 6hrhA
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), H218 (= H213), T246 (= T241), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qreA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z117233350
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qreA
- binding pyridoxal-5'-phosphate: C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), T246 (= T241), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
Sites not aligning to the query:
5qrcA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31721798
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qrcA
- binding 3-cyclohexyl-1-(morpholin-4-yl)propan-1-one: K129 (≠ D124), I130 (≠ D125), Y271 (≠ R267)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qraA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z1101755952
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qraA
- binding [(4R)-4-methyl-2,3,4,5-tetrahydro-1H-azepin-1-yl](1,3-thiazol-4-yl)methanone: K129 (≠ D124), I130 (≠ D125), Y271 (≠ R267)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), T246 (= T241), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qr9A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z31478129
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qr9A
- binding ethyl benzylcarbamate: H206 (≠ D201), L211 (= L206), D241 (= D236)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qr3A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z915492990
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qr3A
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
Sites not aligning to the query:
5qr1A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z396380540
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qr1A
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: I130 (≠ D125), Y271 (≠ R267)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), T246 (= T241), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qr0A Pandda analysis group deposition -- crystal structure of human alas2a in complex with z730649594
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qr0A
- binding N-[2-(4-hydroxyphenyl)ethyl]pyridine-2-carboxamide: H206 (≠ D201), L211 (= L206), D241 (= D236), T261 (≠ H257), L264 (≠ I260), E300 (= E296), A303 (= A299), A307 (≠ R303), P380 (≠ A375), H381 (≠ A376)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
5qqyA Pandda analysis group deposition -- crystal structure of human alas2a in complex with z2856434899
37% identity, 87% coverage: 47:393/400 of query aligns to 52:402/429 of 5qqyA
- binding 1-[(2,5-dihydrothiophen-3-yl)methyl]piperidin-4-ol: K129 (≠ D124), Y271 (≠ R267)
- binding pyridoxal-5'-phosphate: S115 (= S110), C116 (= C111), F117 (= F112), H143 (= H136), E186 (≠ D181), S190 (= S185), D215 (= D210), V217 (≠ S212), H218 (= H213), T246 (= T241), K249 (= K244), T278 (≠ S274), T279 (≠ N275)
Sites not aligning to the query:
Query Sequence
>RR42_RS22865 FitnessBrowser__Cup4G11:RR42_RS22865
MRDRYLSHLRDTLDTIRADGFHKSERVIASPQAADIRLAGGEHVLNFCANNYLGLADDHR
LIEAARRGLEQDGFGMASVRFICGTQSVHKTLEAVLAKFLHTGDSILYSSCFDANGGLFE
TLLDDQDAVISDELNHASIIDGVRLCKARRYRYRNNDMADLETRLQEADAAGARFKLIAT
DGVFSMDGIIADLKSICDLADRYGALVMVDDSHAVGFVGEHGRGTPELCGVEGRVDIITG
TLGKALGGASGGYVAAHREIVELLRQRSRPYLFSNSLAPSICAATLKVLELLASEEGAAL
RARVRENGEHFRREMTALGFTLVPGQHPIIPVMLGDAALASGMADALLAEHVYVVGFSFP
VVPKGRARIRTQMSAAHTAEQIERAVAAFAKVGRKFGAIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory