Comparing RR42_RS22880 FitnessBrowser__Cup4G11:RR42_RS22880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
31% identity, 93% coverage: 13:291/301 of query aligns to 6:274/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
30% identity, 73% coverage: 79:299/301 of query aligns to 285:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
30% identity, 71% coverage: 79:291/301 of query aligns to 270:489/490 of 4ki0F
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 74% coverage: 53:276/301 of query aligns to 66:287/313 of P94529
>RR42_RS22880 FitnessBrowser__Cup4G11:RR42_RS22880
MSTRAGAWQALGERWLGALMLAPALIYIALLLGIPFLLSIYYSLSDITVGTRAMHFVGLA
NFQRIVQNPTFWRSLGNALVFTLVSQALVVVLAKILALALLRDFRGKWLVRLLILLPWVA
PISLGSIGWLWIFDPVYSIINWTLRALGLFGPQTWPVWLGQPDLAMASVILVDVWRLLPL
ATVIILAGLHGIPQDIHDAAAMDGAGFWRHLLRINIPLVMPIMLVALLFGIVFTLTDMII
IFVLTRGGPYDTTQVLASLAFFTGIQGGDLAEGAAISLFLFPLLVAVVALLLTIANRVEV
A
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory