Comparing RR42_RS22885 FitnessBrowser__Cup4G11:RR42_RS22885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
25% identity, 89% coverage: 34:288/288 of query aligns to 28:280/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
30% identity, 42% coverage: 167:288/288 of query aligns to 175:295/296 of P68183
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
40% identity, 17% coverage: 153:202/288 of query aligns to 357:406/490 of 4ki0F
Sites not aligning to the query:
>RR42_RS22885 FitnessBrowser__Cup4G11:RR42_RS22885
MRADASHWKHRGARWGARFGHVAILAVFAGFCAFPFYWMLITTFKDVHDLINTANNPFLF
NQPPTLDNLRVLFLETQYLRWIANTLLVGAMVVAITLLLAVPAGYSLARLAGSRGRQLAI
AIFLTYLIPPTILFIPFSRIIGALGLQDSLWSLVLVYPSFTVPFCTWLMMGFFKAVPRDI
EEAAMMDGLSRFGAFLKVVVPLSSAGILTVVIFTLTLVMQEFVYALTFITSSSQYTVSVG
VPTFLVRGDVYFWGSLMGACLVVSVPVAVLYNLFVDRFVAGFTVGAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory