Comparing RR42_RS23085 FitnessBrowser__Cup4G11:RR42_RS23085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q1JUQ0 L-2-keto-3-deoxyarabonate dehydratase; L-KDA dehydratase; 2-dehydro-3-deoxy-L-arabinonate dehydratase; L-2-keto-3-deoxyarabinonate dehydratase; EC 4.2.1.43 from Azospirillum brasilense (see paper)
70% identity, 99% coverage: 3:308/308 of query aligns to 4:309/309 of Q1JUQ0
Sites not aligning to the query:
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
31% identity, 90% coverage: 9:284/308 of query aligns to 4:275/291 of 3na8A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
28% identity, 78% coverage: 8:247/308 of query aligns to 3:242/298 of 3nevA
3qfeA Crystal structures of a putative dihydrodipicolinate synthase family protein from coccidioides immitis
28% identity, 77% coverage: 10:245/308 of query aligns to 9:239/305 of 3qfeA
Sites not aligning to the query:
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
25% identity, 91% coverage: 8:288/308 of query aligns to 3:281/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
25% identity, 91% coverage: 8:288/308 of query aligns to 2:280/294 of Q9X1K9
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
26% identity, 93% coverage: 8:292/308 of query aligns to 2:283/294 of 4i7wA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
25% identity, 91% coverage: 14:292/308 of query aligns to 10:281/291 of 3pueB
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
26% identity, 93% coverage: 8:292/308 of query aligns to 2:283/294 of Q8UGL3
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
25% identity, 84% coverage: 17:275/308 of query aligns to 18:270/297 of 5j5dA
Sites not aligning to the query:
>RR42_RS23085 FitnessBrowser__Cup4G11:RR42_RS23085
MPSIQPAYRGVFPVAPTIFDEQGGLDLDGQRRCIDFMIDAGSNGICILANFSEQFVLADD
ERSLLMTTVLEHVAGRVPVIVTTTHFSSRICAERSRAAQDAGAAMVMVMPPYHGATIRVP
ERAIYEFFATVSAAIDIPIMIQDAPVSGTTLSAPFLARMAKEIANVSYFKIEVPQAAVKL
RELIALGGDAIVGPWDGEEAITLMADLDAGATGAMTGAGFPDGIRKIVDAYQAGDTELAA
QHYQQWLPLINYENRQGWLATAKALMKEGGVIASDALRHPLQPMHPATRAGLLQIARRLD
PMVLRWGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory