Comparing RR42_RS23235 FitnessBrowser__Cup4G11:RR42_RS23235 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
38% identity, 91% coverage: 1:260/286 of query aligns to 24:284/296 of 3w6zA
Sites not aligning to the query:
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
38% identity, 91% coverage: 1:260/286 of query aligns to 24:281/293 of 3ws7A
Sites not aligning to the query:
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
29% identity, 95% coverage: 1:273/286 of query aligns to 14:289/294 of 5je8B
Sites not aligning to the query:
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
31% identity, 96% coverage: 1:274/286 of query aligns to 12:286/287 of 3pefA
Sites not aligning to the query:
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
29% identity, 96% coverage: 1:274/286 of query aligns to 49:330/335 of P29266
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 96% coverage: 1:274/286 of query aligns to 12:286/287 of 3pduA
Sites not aligning to the query:
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
29% identity, 96% coverage: 1:274/286 of query aligns to 50:331/336 of P31937
Sites not aligning to the query:
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
29% identity, 96% coverage: 1:274/286 of query aligns to 11:292/296 of 2i9pB
Sites not aligning to the query:
1wp4A Structure of tt368 protein from thermus thermophilus hb8 (see paper)
34% identity, 85% coverage: 40:281/286 of query aligns to 50:287/288 of 1wp4A
Sites not aligning to the query:
2cvzC Structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 (see paper)
34% identity, 85% coverage: 40:281/286 of query aligns to 51:288/289 of 2cvzC
Sites not aligning to the query:
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
29% identity, 97% coverage: 1:277/286 of query aligns to 11:289/295 of 6smzC
Sites not aligning to the query:
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
29% identity, 97% coverage: 1:277/286 of query aligns to 11:289/294 of 6smyA
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
29% identity, 97% coverage: 1:277/286 of query aligns to 12:290/298 of P0A9V8
Sites not aligning to the query:
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
34% identity, 81% coverage: 1:231/286 of query aligns to 12:250/298 of Q9I5I6
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
34% identity, 81% coverage: 1:231/286 of query aligns to 11:248/294 of 3q3cA
Sites not aligning to the query:
2uyyA Structure of the cytokine-like nuclear factor n-pac
26% identity, 95% coverage: 1:272/286 of query aligns to 17:289/292 of 2uyyA
Sites not aligning to the query:
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
32% identity, 97% coverage: 1:278/286 of query aligns to 11:292/292 of 5y8iA
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
32% identity, 96% coverage: 1:274/286 of query aligns to 12:289/290 of 5y8lB
Sites not aligning to the query:
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
32% identity, 96% coverage: 1:274/286 of query aligns to 12:289/290 of 5y8kA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
32% identity, 96% coverage: 1:274/286 of query aligns to 11:288/291 of 5y8hA
Sites not aligning to the query:
>RR42_RS23235 FitnessBrowser__Cup4G11:RR42_RS23235
MGTPMAANLIAGGHEVSLSSRSGVPQSLLDSGGVACSSGKEVAERADVIFLMVPDTPHVE
AALFNNGGIAAGLSAGKIVVDMSSISPIATKAFAERVNALGCQYLDAPVSGGEVGARNAT
LSIMVGGPQATFETVRPLFELMGKNITLVGDNGAGQTAKVANQIIVALNIEAVAEALLFA
SKAGADPARVRQALMGGFASSKVLEVHGERMIKRTFDPGFRIGLHQKDLNLALSNAREMG
VSLPNTATCQELFNACASHGGSDWDHSALVRALELMANHEVAAKKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory