SitesBLAST
Comparing RR42_RS23450 FitnessBrowser__Cup4G11:RR42_RS23450 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
38% identity, 97% coverage: 3:259/264 of query aligns to 1:249/257 of 6slbAAA
- active site: Q64 (≠ G66), F69 (≠ M71), L80 (≠ F84), N84 (≠ S88), A108 (≠ L118), S111 (≠ D121), A130 (≠ S140), F131 (≠ Y141), L136 (= L146), P138 (= P148), D139 (= D149), A224 (= A234), G234 (≠ Y244)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K60), A62 (= A64), Q64 (≠ G66), D65 (= D67), L66 (≠ V68), Y76 (≠ G80), A108 (≠ L118), F131 (≠ Y141), D139 (= D149)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
37% identity, 94% coverage: 12:259/264 of query aligns to 7:237/245 of 6slaAAA
- active site: Q61 (≠ G66), L68 (≠ R73), N72 (≠ H94), A96 (≠ L118), S99 (≠ D121), A118 (≠ S140), F119 (≠ Y141), L124 (= L146), P126 (= P148), N127 (≠ D149), A212 (= A234), G222 (≠ Y244)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ R26), A59 (= A64), Q61 (≠ G66), D62 (= D67), L63 (≠ V68), L68 (≠ R73), Y71 (≠ V93), A94 (= A116), G95 (= G117), A96 (≠ L118), F119 (≠ Y141), I122 (≠ R144), L124 (= L146), N127 (≠ D149), F234 (= F256), K237 (= K259)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
32% identity, 97% coverage: 4:259/264 of query aligns to 3:251/259 of 5zaiC
- active site: A65 (≠ G66), F70 (≠ M71), S82 (≠ Q90), R86 (≠ H94), G110 (≠ L118), E113 (≠ D121), P132 (≠ S140), E133 (≠ Y141), I138 (≠ L146), P140 (= P148), G141 (≠ D149), A226 (= A234), F236 (≠ Y244)
- binding coenzyme a: K24 (= K25), L25 (≠ R26), A63 (= A64), G64 (= G65), A65 (≠ G66), D66 (= D67), I67 (≠ V68), P132 (≠ S140), R166 (≠ K174), F248 (= F256), K251 (= K259)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
33% identity, 94% coverage: 13:259/264 of query aligns to 15:250/258 of 1mj3A
- active site: A68 (≠ G66), M73 (= M71), S83 (≠ V82), L85 (≠ F84), G109 (≠ L118), E112 (≠ D121), P131 (≠ S140), E132 (≠ Y141), T137 (≠ L146), P139 (= P148), G140 (≠ D149), K225 (≠ Q238), F235 (vs. gap)
- binding hexanoyl-coenzyme a: K26 (≠ E24), A27 (≠ K25), L28 (≠ R26), A30 (= A28), A66 (= A64), G67 (= G65), A68 (≠ G66), D69 (= D67), I70 (≠ V68), G109 (≠ L118), P131 (≠ S140), E132 (≠ Y141), L135 (≠ R144), G140 (≠ D149)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
32% identity, 94% coverage: 13:259/264 of query aligns to 14:246/254 of 2dubA
- active site: A67 (≠ G66), M72 (= M71), S82 (≠ N85), G105 (≠ L118), E108 (≠ D121), P127 (≠ S140), E128 (≠ Y141), T133 (≠ L146), P135 (= P148), G136 (≠ D149), K221 (≠ Q238), F231 (vs. gap)
- binding octanoyl-coenzyme a: K25 (≠ E24), A26 (≠ K25), L27 (≠ R26), A29 (= A28), A65 (= A64), A67 (≠ G66), D68 (= D67), I69 (≠ V68), K70 (≠ S69), G105 (≠ L118), E108 (≠ D121), P127 (≠ S140), E128 (≠ Y141), G136 (≠ D149), A137 (≠ G150)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
32% identity, 94% coverage: 13:259/264 of query aligns to 13:250/258 of 1ey3A
- active site: A66 (≠ G66), M71 (= M71), S81 (≠ Q79), L85 (≠ F84), G109 (≠ L118), E112 (≠ D121), P131 (≠ S140), E132 (≠ Y141), T137 (≠ L146), P139 (= P148), G140 (≠ D149), K225 (≠ Q238), F235 (vs. gap)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E24), L26 (≠ R26), A28 (= A28), A64 (= A64), G65 (= G65), A66 (≠ G66), D67 (= D67), I68 (≠ V68), L85 (≠ F84), W88 (= W87), G109 (≠ L118), P131 (≠ S140), L135 (≠ R144), G140 (≠ D149)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
32% identity, 94% coverage: 13:259/264 of query aligns to 15:252/260 of 1dubA
- active site: A68 (≠ G66), M73 (= M71), S83 (≠ Q79), L87 (≠ F84), G111 (≠ L118), E114 (≠ D121), P133 (≠ S140), E134 (≠ Y141), T139 (≠ L146), P141 (= P148), G142 (≠ D149), K227 (≠ Q238), F237 (vs. gap)
- binding acetoacetyl-coenzyme a: K26 (≠ E24), A27 (≠ K25), L28 (≠ R26), A30 (= A28), A66 (= A64), A68 (≠ G66), D69 (= D67), I70 (≠ V68), Y107 (≠ A114), G110 (= G117), G111 (≠ L118), E114 (≠ D121), P133 (≠ S140), E134 (≠ Y141), L137 (≠ R144), G142 (≠ D149), F233 (≠ Y244), F249 (= F256)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 94% coverage: 13:259/264 of query aligns to 45:282/290 of P14604
- E144 (≠ D121) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (≠ Y141) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
32% identity, 93% coverage: 15:259/264 of query aligns to 17:252/260 of 2hw5C
- active site: A68 (≠ G66), M73 (= M71), S83 (= S88), L87 (≠ R92), G111 (≠ L118), E114 (≠ D121), P133 (≠ S140), E134 (≠ Y141), T139 (≠ L146), P141 (= P148), G142 (≠ D149), K227 (≠ Q238), F237 (vs. gap)
- binding crotonyl coenzyme a: K26 (≠ E24), A27 (≠ K25), L28 (≠ R26), A30 (= A28), K62 (= K60), I70 (≠ V68), F109 (≠ A116)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
33% identity, 98% coverage: 1:259/264 of query aligns to 9:261/273 of Q5HH38
- R34 (= R26) binding in other chain
- SGGD---Q 73:77 (≠ AGGDVSGM 64:71) binding in other chain
- S149 (≠ L146) binding in other chain
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 98% coverage: 3:261/264 of query aligns to 1:250/256 of 3h81A
- active site: A64 (≠ G66), M69 (= M71), T79 (≠ E81), F83 (≠ N85), G107 (≠ L118), E110 (≠ D121), P129 (≠ S140), E130 (≠ Y141), V135 (≠ L146), P137 (= P148), G138 (≠ D149), L223 (≠ A234), F233 (≠ Y244)
- binding calcium ion: F233 (≠ Y244), Q238 (≠ H249)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 98% coverage: 3:261/264 of query aligns to 2:251/255 of 3q0jC
- active site: A65 (≠ G66), M70 (= M71), T80 (≠ E81), F84 (≠ N85), G108 (≠ L118), E111 (≠ D121), P130 (≠ S140), E131 (≠ Y141), V136 (≠ L146), P138 (= P148), G139 (≠ D149), L224 (≠ C243), F234 (vs. gap)
- binding acetoacetyl-coenzyme a: Q23 (≠ E24), A24 (≠ K25), L25 (≠ R26), A27 (= A28), A63 (= A64), G64 (= G65), A65 (≠ G66), D66 (= D67), I67 (≠ V68), K68 (≠ S69), M70 (= M71), F84 (≠ N85), G107 (= G117), G108 (≠ L118), E111 (≠ D121), P130 (≠ S140), E131 (≠ Y141), P138 (= P148), G139 (≠ D149), M140 (≠ G150)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 98% coverage: 3:261/264 of query aligns to 2:251/255 of 3q0gC
- active site: A65 (≠ G66), M70 (= M71), T80 (≠ E81), F84 (≠ N85), G108 (≠ L118), E111 (≠ D121), P130 (≠ S140), E131 (≠ Y141), V136 (≠ L146), P138 (= P148), G139 (≠ D149), L224 (≠ C243), F234 (vs. gap)
- binding coenzyme a: L25 (≠ R26), A63 (= A64), I67 (≠ V68), K68 (≠ S69), Y104 (≠ A114), P130 (≠ S140), E131 (≠ Y141), L134 (≠ R144)
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
33% identity, 98% coverage: 1:259/264 of query aligns to 4:248/260 of 2uzfA
- active site: G70 (= G66), R80 (≠ Q79), L84 (≠ H94), G108 (≠ L118), V111 (≠ D121), T130 (≠ S140), G131 (≠ Y141), S136 (≠ L146), D138 (≠ P148), A139 (≠ D149), A225 (= A234), Y233 (= Y244)
- binding acetoacetyl-coenzyme a: V28 (≠ K25), R29 (= R26), S68 (≠ A64), G69 (= G65), G70 (= G66), D71 (= D67), Y104 (≠ A114), G108 (≠ L118)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 98% coverage: 3:261/264 of query aligns to 1:246/250 of 3q0gD
- active site: A64 (≠ G66), M69 (= M71), T75 (≠ Q79), F79 (= F84), G103 (≠ L118), E106 (≠ D121), P125 (≠ S140), E126 (≠ Y141), V131 (≠ L146), P133 (= P148), G134 (≠ D149), L219 (≠ C243), F229 (vs. gap)
- binding Butyryl Coenzyme A: F225 (vs. gap), F241 (= F256)
Q62651 Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; EC 5.3.3.- from Rattus norvegicus (Rat) (see paper)
33% identity, 81% coverage: 2:214/264 of query aligns to 52:271/327 of Q62651
- D176 (= D121) mutation D->A,D: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
- E196 (≠ Y141) mutation E->D,Q: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
- D204 (= D149) mutation D->A,N: Strongly decreases dienoyl-CoA and trienoyl-CoA isomerase activity.
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 98% coverage: 2:259/264 of query aligns to 70:325/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
33% identity, 90% coverage: 25:261/264 of query aligns to 25:255/261 of 5jbxB
- active site: A67 (≠ G66), R72 (= R74), L84 (≠ F84), R88 (≠ S88), G112 (≠ L118), E115 (≠ D121), T134 (≠ S140), E135 (≠ Y141), I140 (≠ L146), P142 (= P148), G143 (≠ D149), A228 (= A234), L238 (≠ Y244)
- binding coenzyme a: R25 (≠ K25), R26 (= R26), A28 (= A28), A65 (= A64), D68 (= D67), L69 (≠ M71), K70 (= K72), L110 (≠ A116), G111 (= G117), T134 (≠ S140), E135 (≠ Y141), L138 (≠ R144), R168 (≠ K174)
Sites not aligning to the query:
2vssD Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin (see paper)
31% identity, 86% coverage: 4:231/264 of query aligns to 6:231/246 of 2vssD
- active site: M68 (≠ G66), Y73 (≠ M71), D78 (≠ E76), R90 (≠ Q90), Q94 (≠ H94), G118 (≠ L118), S121 (≠ D121), S140 (= S140), E141 (≠ Y141), I146 (≠ L146), P148 (= P148), G149 (≠ D149)
- binding acetyl coenzyme *a: E26 (= E24), K27 (= K25), R28 (= R26), A30 (= A28), A66 (= A64), M68 (≠ G66), D69 (= D67), L70 (≠ V68), F74 (≠ K72), W114 (≠ A114), F116 (≠ A116), S140 (= S140)
- binding 4-hydroxy-3-methoxybenzaldehyde: M68 (≠ G66), Y73 (≠ M71), F74 (≠ K72), Q96 (≠ T96), E141 (≠ Y141), G149 (≠ D149), N150 (≠ G150)
Sites not aligning to the query:
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
33% identity, 84% coverage: 2:222/264 of query aligns to 20:237/285 of Q7CQ56
Query Sequence
>RR42_RS23450 FitnessBrowser__Cup4G11:RR42_RS23450
MENYSLIELKYESGVAVIALNRPEKRNAMSDDMRTEFIDALERVAADKAVRALVITGNGK
GFCAGGDVSGMKRRMEAPQGEVGFNGWSRQQRVHYTQKLLHTMPKPTVAAVNGAAAGLGA
DTALCCDFVIASEHASFSWSYINRGLIPDGGGMYFLPRRVGLAKAKELVFTGRKVAIEEA
KEIGIVDRVSHADSLVADAVAWAKELSQGSPTAIALGKTIMNQSYELPADQIFAQGSQAQ
GICYTSAEHRESVLAFLNKLADKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory