Comparing RR42_RS23490 FitnessBrowser__Cup4G11:RR42_RS23490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
65% identity, 99% coverage: 3:336/339 of query aligns to 3:337/337 of 1krhA
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
31% identity, 95% coverage: 11:333/339 of query aligns to 7:325/326 of Q03304
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
31% identity, 95% coverage: 11:333/339 of query aligns to 7:325/326 of 4wqmA
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
29% identity, 95% coverage: 15:337/339 of query aligns to 10:334/334 of P0DPQ8
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
29% identity, 95% coverage: 15:337/339 of query aligns to 9:333/333 of 5ogxA
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
32% identity, 69% coverage: 105:339/339 of query aligns to 8:250/250 of 1tvcA
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
26% identity, 93% coverage: 18:333/339 of query aligns to 18:333/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
26% identity, 93% coverage: 18:333/339 of query aligns to 17:320/321 of 7c3aA
Sites not aligning to the query:
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
28% identity, 58% coverage: 136:333/339 of query aligns to 184:396/403 of 3ozwA
Sites not aligning to the query:
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
28% identity, 58% coverage: 136:333/339 of query aligns to 184:396/403 of 3ozvA
Sites not aligning to the query:
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
28% identity, 58% coverage: 136:333/339 of query aligns to 184:396/403 of 3ozuA
Sites not aligning to the query:
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
28% identity, 58% coverage: 136:333/339 of query aligns to 184:396/403 of P39662
Sites not aligning to the query:
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
28% identity, 58% coverage: 136:333/339 of query aligns to 184:396/403 of 1cqxA
Sites not aligning to the query:
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
31% identity, 54% coverage: 140:322/339 of query aligns to 45:238/255 of 7romA
1iueA Crystal structure analysis of ferredoxin from plasmodium falciparum
40% identity, 27% coverage: 3:93/339 of query aligns to 3:88/98 of 1iueA
Q8IED5 Ferredoxin, apicoplast from Plasmodium falciparum (isolate 3D7) (see paper)
40% identity, 27% coverage: 3:93/339 of query aligns to 99:184/194 of Q8IED5
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
28% identity, 59% coverage: 133:333/339 of query aligns to 179:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 59% coverage: 133:333/339 of query aligns to 179:390/396 of P24232
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
25% identity, 93% coverage: 18:333/339 of query aligns to 17:305/306 of 7c3bB
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
24% identity, 43% coverage: 189:333/339 of query aligns to 136:288/289 of 2r6hC
Sites not aligning to the query:
>RR42_RS23490 FitnessBrowser__Cup4G11:RR42_RS23490
MEYNIALQFEDGVTRFITCTANETLSDAAYRQQINIPLDCRDGACGTCRGLCESGEYDLP
ASSYIEDALTPEEAAKGYVLACQTRPRSDCVIKVPASSAACKTGVTRYQGKLAAVDKLSD
STIGFSIDLGEAAAPTFLAGQYVNVDIPGTGLTRSYSFSSAPGAARTSFVVRNVPNGRMS
EFLSNEALPGQPISFAGPYGSFYLREVARPVLFLAGGTGIAPFLSMLDVLAANGSPHPIR
LVYGVTHEIDLVALAQLDRAKDQLAGFEYRTCVLDPVSNETRKGYVTQHVERDWLNGGDV
DIYLCGPVAMVDAVRAWLQDAGVTPASFHYEKFSASNAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory