SitesBLAST
Comparing RR42_RS23500 FitnessBrowser__Cup4G11:RR42_RS23500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
46% identity, 93% coverage: 26:455/462 of query aligns to 24:457/471 of O85673
- M43 (= M45) mutation to K: Prevents anthranilate degradation.
- D217 (= D221) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
28% identity, 77% coverage: 29:386/462 of query aligns to 16:369/424 of 3en1A
- active site: H105 (= H118), D205 (= D221), H208 (= H224), H214 (= H238), D360 (= D377)
- binding fe (ii) ion: Q201 (≠ N218), H208 (= H224), H214 (= H238), D360 (= D377)
- binding fe2/s2 (inorganic) cluster: C82 (= C95), H84 (= H97), R85 (= R98), C102 (= C115), Y104 (≠ F117), H105 (= H118), W107 (= W120)
- binding toluene: Q201 (≠ N218), F202 (vs. gap), D205 (= D221), H208 (= H224), H295 (≠ N311)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
29% identity, 80% coverage: 19:386/462 of query aligns to 9:361/425 of 1uljA
- active site: H105 (= H118), D205 (= D221), H208 (= H224), H214 (= H238), D352 (= D377)
- binding biphenyl: Q201 (≠ N218), F202 (vs. gap), D205 (= D221), M206 (≠ G222), H208 (= H224), A209 (= A233), H214 (= H238), I252 (≠ W275), H287 (≠ N311), L297 (≠ M321), F342 (= F367)
- binding fe (ii) ion: Q201 (≠ N218), H208 (= H224), H214 (= H238), D352 (= D377)
- binding fe2/s2 (inorganic) cluster: C82 (= C95), H84 (= H97), R85 (= R98), M87 (≠ A100), C102 (= C115), Y104 (≠ F117), H105 (= H118), W107 (= W120)
7ylsB Structure of a bacteria protein complex
28% identity, 81% coverage: 27:400/462 of query aligns to 16:399/436 of 7ylsB
8h2tB Cryo-em structure of iadd/e dioxygenase bound with iaa (see paper)
28% identity, 81% coverage: 27:400/462 of query aligns to 15:398/435 of 8h2tB
- binding fe (iii) ion: N208 (= N218), H214 (= H224), H219 (= H229), D375 (= D377)
- binding fe2/s2 (inorganic) cluster: C83 (= C95), H85 (= H97), K86 (≠ R98), C104 (= C115), H107 (= H118), W109 (= W120)
- binding 1h-indol-3-ylacetic acid: N208 (= N218), L209 (≠ G219), D211 (= D221), H214 (= H224), P215 (≠ V225), F249 (vs. gap), K320 (≠ M321), Y360 (= Y363)
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
30% identity, 80% coverage: 19:386/462 of query aligns to 9:359/425 of 1uliC
- active site: H105 (= H118), D205 (= D221), H208 (= H224), H214 (= H238), D350 (= D377)
- binding fe (ii) ion: H208 (= H224), H214 (= H238), D350 (= D377)
- binding fe2/s2 (inorganic) cluster: C82 (= C95), H84 (= H97), R85 (= R98), C102 (= C115), Y104 (≠ F117), H105 (= H118), W107 (= W120)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
29% identity, 80% coverage: 19:386/462 of query aligns to 25:387/460 of Q53122
- C98 (= C95) binding
- H100 (= H97) binding
- C118 (= C115) binding
- H121 (= H118) binding
- 217:230 (vs. 218:238, 32% identical) binding
- H224 (= H224) binding
- H230 (= H238) binding
- D378 (= D377) binding
4hm8A Naphthalene 1,2-dioxygenase bound to thioanisole
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm8A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding (methylsulfanyl)benzene: N201 (= N218), H295 (≠ S309)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
4hm7A Naphthalene 1,2-dioxygenase bound to styrene
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm7A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
- binding ethenylbenzene: N201 (= N218), H208 (= H224), H295 (≠ S309), N297 (= N311)
4hm6A Naphthalene 1,2-dioxygenase bound to phenetole
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm6A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding ethoxybenzene: N201 (= N218), H208 (= H224), H295 (≠ S309)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
4hm4A Naphthalene 1,2-dioxygenase bound to indan
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm4A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding 2,3-dihydro-1H-indene: H208 (= H224), H295 (≠ S309), N297 (= N311)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
4hm3A Naphthalene 1,2-dioxygenase bound to ethylbenzene
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm3A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
- binding phenylethane: N201 (= N218), D205 (= D221), H208 (= H224), N297 (= N311)
4hm2A Naphthalene 1,2-dioxygenase bound to ethylphenylsulfide
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm2A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding (ethylsulfanyl)benzene: N201 (= N218), D205 (= D221), V209 (= V225), H295 (≠ S309), N297 (= N311)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
4hm1A Naphthalene 1,2-dioxygenase bound to 1-indanone
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hm1A
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding 2,3-dihydro-1H-inden-1-one: N201 (= N218), V209 (= V225), N297 (= N311)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
4hkvA Naphthalene 1,2-dioxygenase bound to benzamide
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hkvA
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
- binding benzamide: N201 (= N218), H208 (= H224), H295 (≠ S309), N297 (= N311)
4hjlA Naphthalene 1,2-dioxygenase bound to 1-chloronaphthalene
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 4hjlA
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding 1-chloronaphthalene: N201 (= N218), D205 (= D221), H208 (= H224), H295 (≠ S309), N297 (= N311), L307 (≠ M321)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
2hmoA Crystal structure of naphthalene 1,2-dioxygenase bound to 3- nitrotoluene. (see paper)
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 2hmoA
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding 3-nitrotoluene: N201 (= N218), N297 (= N311), W358 (≠ A373)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
2hmmA Crystal structure of naphthalene 1,2-dioxygenase bound to anthracene (see paper)
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 2hmmA
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding anthracene: N201 (= N218), D205 (= D221), H208 (= H224), V209 (= V225), F224 (≠ R250), N297 (= N311)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
2hmkA Crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene (see paper)
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/446 of 2hmkA
- active site: H104 (= H118), D205 (= D221), H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe (iii) ion: H208 (= H224), H213 (≠ Y232), D362 (= D377)
- binding fe2/s2 (inorganic) cluster: C81 (= C95), H83 (= H97), R84 (= R98), C101 (= C115), Y103 (≠ F117), H104 (= H118), W106 (= W120)
- binding phenanthrene: N201 (= N218), D205 (= D221), H208 (= H224), V209 (= V225), F224 (≠ R250), N297 (= N311)
P0A111 Naphthalene 1,2-dioxygenase system, large oxygenase component; ISP NAP; Naphthalene 1,2-dioxygenase ISP alpha; Naphthalene 1,2-dioxygenase subunit alpha; ND subunit alpha; NDO subunit alpha; EC 1.14.12.12 from Pseudomonas sp. (strain C18) (see paper)
30% identity, 76% coverage: 37:386/462 of query aligns to 23:371/449 of P0A111
- C81 (= C95) binding
- H83 (= H97) binding
- C101 (= C115) binding
- H104 (= H118) binding
- H208 (= H224) binding
- H213 (≠ Y232) binding
- F352 (= F367) mutation to V: Changes the regioselectivity of the product for naphthalene, phenanthrene and biphenyl.
- D362 (= D377) binding
Query Sequence
>RR42_RS23500 FitnessBrowser__Cup4G11:RR42_RS23500
MIPIYPDHSPALKRLDDYLVENRETGDHRLHRSAFTDEALFELEMKHIFEGNWIYLAHES
QIPGNNDYYTTYIGRQPIVIARNRQGELNALINACTHRGAMLCRHKRGNKATYTCPFHGW
TFNNSGKLLKVKDPEGAGYPDCFNKEASHDLKKVARFENYRGFLFGSLNPDVAPLKDFLG
EAAKIIDMIVDQSADGLEVLRGASTYTFEGNWKLQTENGADGYHVSAVHWNYAATTNHRK
QENAREDKIRAMDAGNWGRQGGGFYAFDHGHMLLWSRWANPEDRPNFNRREEFAERCGAE
TADWMIQNSRNLCLYPNVYLMDQFGSQIRVLRPLSVDKTEVTIYCIAPKGEADDARARRI
RQYEDFFNVSGMATPDDLEEFRACQQGYAGSAVAWNDMCRGATHWVEGADEAARKIGLKP
LMSGVKTEDEGLYTVQHRYWLDVMKKATGAEASKISSAGSEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory