Comparing RR42_RS23505 FitnessBrowser__Cup4G11:RR42_RS23505 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
65% identity, 99% coverage: 5:304/304 of query aligns to 8:309/309 of 2xsrA
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
57% identity, 95% coverage: 15:304/304 of query aligns to 19:305/309 of 2azqA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
53% identity, 93% coverage: 23:304/304 of query aligns to 27:311/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
53% identity, 93% coverage: 23:304/304 of query aligns to 25:309/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
53% identity, 93% coverage: 23:304/304 of query aligns to 25:309/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
53% identity, 93% coverage: 23:304/304 of query aligns to 25:309/309 of 1dlmA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
52% identity, 99% coverage: 5:304/304 of query aligns to 9:308/310 of 5umhB
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
51% identity, 98% coverage: 5:303/304 of query aligns to 8:306/307 of 5td3A
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
51% identity, 92% coverage: 25:304/304 of query aligns to 31:311/312 of 5vxtB
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3i51A
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3i4yA
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3hjsA
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3hjqA
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3hhyA
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 53:234/256 of 3hhxA
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 54:235/257 of 3hj8A
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
38% identity, 61% coverage: 72:255/304 of query aligns to 55:236/258 of 3hgiA
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
28% identity, 93% coverage: 6:288/304 of query aligns to 4:286/286 of 3n9tA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
36% identity, 63% coverage: 72:262/304 of query aligns to 48:238/256 of 3o6rA
>RR42_RS23505 FitnessBrowser__Cup4G11:RR42_RS23505
MTHPEIEALVKAFILDTASGKADARVQSVVVRLTTDLFKAIEDLDLSASEVWKGIEYFAE
AGPELGLLAAGLGLERFLDIRADEAEAKAGLAGGTPRTIEGPLYVAGAPASEGFARLDDG
SEDGQGEVLFMQGTVFDTSGKPLPGASVEVWHANLLGNYSFFDKTQSDFNLRRTITTDSE
GRYQFRSIVPMGYGCPPQGTTQRLLDLLGRHGRRPAHIHFFVSAPGHRKLTTQINIDGDE
YLWDDFAFASREGLVPALRHVESPRALAEHGLDKPFASIDFDFRLYADCAAAPVPEVERT
RAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory