SitesBLAST
Comparing RR42_RS23690 FitnessBrowser__Cup4G11:RR42_RS23690 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 99% coverage: 1:253/255 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G17), N111 (= N114), S139 (= S142), Q149 (≠ E152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ F96), K98 (= K101), S139 (= S142), N146 (≠ S149), V147 (≠ S150), Q149 (≠ E152), Y152 (= Y155), F184 (≠ P187), M189 (≠ L192), K200 (≠ A209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), F39 (≠ L38), V59 (≠ C62), D60 (= D63), V61 (≠ I64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ W93), T137 (≠ I140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ P187), T185 (= T188), T187 (= T190), M189 (≠ L192)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
38% identity, 98% coverage: 4:253/255 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (= D37), I36 (≠ L38), I62 (= I64), N88 (= N90), G90 (= G92), I138 (= I140), S140 (= S142), Y152 (= Y155), K156 (= K159), I185 (≠ T188)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
38% identity, 98% coverage: 4:253/255 of query aligns to 3:245/248 of Q9KJF1
- S15 (≠ G16) binding
- D36 (= D37) binding
- D62 (= D63) binding
- I63 (= I64) binding
- N89 (= N90) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
39% identity, 98% coverage: 3:253/255 of query aligns to 5:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G13), R18 (≠ G16), G19 (= G17), I20 (= I18), D39 (= D37), R40 (≠ L38), C63 (= C62), I65 (= I64), N91 (= N90), G93 (= G92), I94 (≠ W93), V114 (≠ I113), Y155 (= Y155), K159 (= K159), I188 (≠ T188), T190 (= T190), T193 (≠ K197)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
34% identity, 98% coverage: 4:253/255 of query aligns to 6:242/243 of 4i08A
- active site: G19 (= G17), N113 (= N114), S141 (= S142), Q151 (≠ E152), Y154 (= Y155), K158 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ G16), I20 (= I18), T40 (≠ L38), N62 (≠ D63), V63 (≠ I64), N89 (= N90), A90 (= A91), G140 (≠ A141), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), T189 (= T190)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
35% identity, 98% coverage: 4:253/255 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ G15), R18 (≠ G16), I20 (= I18), T40 (≠ L38), N62 (≠ D63), V63 (≠ I64), N89 (= N90), A90 (= A91), I92 (≠ W93), V139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I187 (≠ T188), T189 (= T190), M191 (≠ L192)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 99% coverage: 1:252/255 of query aligns to 2:253/255 of 5itvA
- active site: G18 (= G17), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ G16), G18 (= G17), I19 (= I18), D38 (= D37), I39 (≠ L38), T61 (≠ C62), I63 (= I64), N89 (= N90), G91 (= G92), T139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I186 (≠ P187), I187 (≠ T188)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 98% coverage: 4:253/255 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S142), Q152 (≠ E152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ G16), G16 (= G17), I17 (= I18), N35 (≠ D37), Y36 (≠ L38), N37 (= N39), G38 (≠ L40), S39 (≠ A41), N63 (≠ D63), V64 (≠ I64), N90 (= N90), A91 (= A91), I93 (≠ W93), I113 (= I113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ T188), T190 (= T190)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
36% identity, 98% coverage: 4:253/255 of query aligns to 3:243/244 of P0AEK2
- GASR 12:15 (≠ GGGG 13:16) binding
- T37 (≠ A42) binding
- NV 59:60 (≠ DI 63:64) binding
- N86 (= N90) binding
- Y151 (= Y155) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAACK 155:159) binding
- A154 (≠ C158) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K159) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T188) binding
- E233 (≠ Q243) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
36% identity, 98% coverage: 4:253/255 of query aligns to 2:242/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ Q106), S137 (= S142), Q147 (≠ E152), Y150 (= Y155), K154 (= K159)
- binding calcium ion: E232 (≠ Q243), T233 (≠ V244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ G16), T36 (≠ A42), N58 (≠ D63), V59 (≠ I64), N85 (= N90), A86 (= A91), G87 (= G92), I88 (≠ W93), S137 (= S142), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (= G186), I183 (≠ T188)
6pejA Structure of sorbitol dehydrogenase from sinorhizobium meliloti 1021 bound to sorbitol
36% identity, 100% coverage: 1:254/255 of query aligns to 1:257/257 of 6pejA
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
39% identity, 96% coverage: 9:253/255 of query aligns to 4:244/244 of 1edoA
- active site: G12 (= G17), S138 (= S142), Y151 (= Y155), K155 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ G15), R11 (≠ G16), I13 (= I18), N31 (= N39), Y32 (≠ L40), A33 (= A41), R34 (vs. gap), S35 (vs. gap), D59 (= D63), V60 (≠ I64), N86 (= N90), A87 (= A91), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (≠ E194), S186 (≠ Y196), M188 (≠ Q198)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
35% identity, 98% coverage: 4:253/255 of query aligns to 2:242/243 of 7emgB
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
35% identity, 98% coverage: 4:253/255 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G17), S138 (= S142), Y151 (= Y155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ G15), R15 (≠ G16), T37 (≠ A42), L58 (≠ C62), N59 (≠ D63), V60 (≠ I64), A87 (= A91), G88 (= G92), I89 (≠ W93)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
35% identity, 98% coverage: 4:253/255 of query aligns to 2:242/243 of 1q7cA
- active site: G15 (= G17), S137 (= S142), Q147 (≠ E152), F150 (≠ Y155), K154 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ G15), R14 (≠ G16), A35 (= A41), T36 (≠ A42), L57 (≠ C62), N58 (≠ D63), V59 (≠ I64), G87 (= G92), I88 (≠ W93)
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
38% identity, 88% coverage: 28:252/255 of query aligns to 29:253/255 of A7IQH5
- D38 (= D37) binding
- DV 64:65 (≠ DI 63:64) binding
- N91 (= N90) binding
- S143 (= S142) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y155) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K159) binding ; mutation to A: Loss of activity.
- T188 (≠ P187) binding
- VTSTG 189:193 (≠ -TDTA 188:191) binding
- R211 (≠ A209) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ R212) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ I214) binding
Sites not aligning to the query:
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
33% identity, 98% coverage: 2:250/255 of query aligns to 1:260/260 of 1zemA
- active site: N16 (≠ G17), S142 (= S142), Y155 (= Y155), K159 (= K159), D212 (≠ N202)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G15 (= G16), N16 (≠ G17), I17 (= I18), D36 (= D37), M37 (≠ L38), D62 (= D63), V63 (≠ I64), N89 (= N90), A90 (= A91), G91 (= G92), T140 (≠ I140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), M188 (≠ T188)
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
38% identity, 88% coverage: 28:252/255 of query aligns to 27:251/253 of 4ituA
- active site: N113 (= N114), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S142), Y154 (= Y155), T186 (≠ P187), R209 (≠ A209), Y213 (≠ I214)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D37), L37 (= L38), D62 (= D63), V63 (≠ I64), N89 (= N90), V112 (≠ I113), F139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), T186 (≠ P187), V187 (vs. gap), T190 (= T190), M192 (≠ L192)
Sites not aligning to the query:
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
38% identity, 97% coverage: 4:250/255 of query aligns to 7:247/251 of 6d9yB
- active site: G20 (= G17), S145 (= S142), Y158 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G16 (= G13), R19 (≠ G16), G20 (= G17), D40 (= D37), L41 (= L38), V64 (≠ C62), D65 (= D63), Q66 (≠ I64), A93 (= A91), S145 (= S142), Y158 (= Y155), K162 (= K159), P188 (= P185), A189 (≠ G186), A190 (≠ P187), A191 (≠ T188), T193 (= T190)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
35% identity, 98% coverage: 4:253/255 of query aligns to 3:243/244 of P0A2C9
- M125 (= M129) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A233) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S234) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>RR42_RS23690 FitnessBrowser__Cup4G11:RR42_RS23690
MQRLEGKTVIVTGGGGGIGGATCRRFAREGAAVAVLDLNLAAAQQVAQRIREEGGRAEAF
QCDITDRASVDAAVAATTSQLGPIDVLVNNAGWDVFKPFTKTEPAQWDRLIAINLTGALH
MHHAVLPGMVERKRGRIVNIASDAARVGSSGEAVYAACKGGLVSFSKTIAREHARHGITV
NVVCPGPTDTALFEDYKQGAGNPEKLIEAFTRSIPLGRIGQPEDLPGAIVFFASDDAAFV
TGQVLSVSGGLTMNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory