SitesBLAST
Comparing RR42_RS23710 FitnessBrowser__Cup4G11:RR42_RS23710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
59% identity, 99% coverage: 4:249/249 of query aligns to 12:256/256 of 3h81A
- active site: A64 (= A56), M69 (= M61), T79 (≠ K71), F83 (≠ I75), G107 (= G100), E110 (= E103), P129 (= P122), E130 (= E123), V135 (= V128), P137 (= P130), G138 (= G131), L223 (= L216), F233 (= F226)
- binding calcium ion: F233 (= F226), Q238 (≠ L231)
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
59% identity, 98% coverage: 4:246/249 of query aligns to 13:254/255 of 3q0jC
- active site: A65 (= A56), M70 (= M61), T80 (≠ K71), F84 (≠ I75), G108 (= G100), E111 (= E103), P130 (= P122), E131 (= E123), V136 (= V128), P138 (= P130), G139 (= G131), L224 (= L216), F234 (= F226)
- binding acetoacetyl-coenzyme a: Q23 (≠ R14), A24 (≠ Q15), L25 (≠ M16), A27 (= A18), A63 (= A54), G64 (= G55), A65 (= A56), D66 (= D57), I67 (= I58), K68 (≠ A59), M70 (= M61), F84 (≠ I75), G107 (= G99), G108 (= G100), E111 (= E103), P130 (= P122), E131 (= E123), P138 (= P130), G139 (= G131), M140 (≠ A132)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
59% identity, 98% coverage: 4:246/249 of query aligns to 13:254/255 of 3q0gC
- active site: A65 (= A56), M70 (= M61), T80 (≠ K71), F84 (≠ I75), G108 (= G100), E111 (= E103), P130 (= P122), E131 (= E123), V136 (= V128), P138 (= P130), G139 (= G131), L224 (= L216), F234 (= F226)
- binding coenzyme a: L25 (≠ M16), A63 (= A54), I67 (= I58), K68 (≠ A59), Y104 (= Y96), P130 (= P122), E131 (= E123), L134 (= L126)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
59% identity, 98% coverage: 4:246/249 of query aligns to 12:249/250 of 3q0gD
- active site: A64 (= A56), M69 (= M61), T75 (≠ K71), F79 (≠ I75), G103 (= G100), E106 (= E103), P125 (= P122), E126 (= E123), V131 (= V128), P133 (= P130), G134 (= G131), L219 (= L216), F229 (= F226)
- binding Butyryl Coenzyme A: F225 (≠ L222), F241 (= F238)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
49% identity, 98% coverage: 5:249/249 of query aligns to 17:260/260 of 2hw5C
- active site: A68 (= A56), M73 (= M61), S83 (≠ K71), L87 (≠ I75), G111 (= G100), E114 (= E103), P133 (= P122), E134 (= E123), T139 (≠ V128), P141 (= P130), G142 (= G131), K227 (≠ L216), F237 (= F226)
- binding crotonyl coenzyme a: K26 (≠ R14), A27 (≠ Q15), L28 (≠ M16), A30 (= A18), K62 (= K50), I70 (= I58), F109 (≠ L98)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
47% identity, 98% coverage: 5:247/249 of query aligns to 15:256/258 of 1ey3A
- active site: A66 (= A56), M71 (= M61), S81 (≠ K71), L85 (≠ I75), G109 (= G100), E112 (= E103), P131 (= P122), E132 (= E123), T137 (≠ V128), P139 (= P130), G140 (= G131), K225 (≠ L216), F235 (= F226)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ R14), L26 (≠ M16), A28 (= A18), A64 (= A54), G65 (= G55), A66 (= A56), D67 (= D57), I68 (= I58), L85 (≠ I75), W88 (= W79), G109 (= G100), P131 (= P122), L135 (= L126), G140 (= G131)
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
47% identity, 98% coverage: 5:247/249 of query aligns to 17:258/260 of 1dubA
- active site: A68 (= A56), M73 (= M61), S83 (≠ K71), L87 (≠ I75), G111 (= G100), E114 (= E103), P133 (= P122), E134 (= E123), T139 (≠ V128), P141 (= P130), G142 (= G131), K227 (≠ L216), F237 (= F226)
- binding acetoacetyl-coenzyme a: K26 (≠ R14), A27 (≠ Q15), L28 (≠ M16), A30 (= A18), A66 (= A54), A68 (= A56), D69 (= D57), I70 (= I58), Y107 (= Y96), G110 (= G99), G111 (= G100), E114 (= E103), P133 (= P122), E134 (= E123), L137 (= L126), G142 (= G131), F233 (≠ L222), F249 (= F238)
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
47% identity, 98% coverage: 5:247/249 of query aligns to 47:288/290 of P14604
- E144 (= E103) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E123) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
47% identity, 98% coverage: 5:247/249 of query aligns to 16:252/254 of 2dubA
- active site: A67 (= A56), M72 (= M61), S82 (≠ K71), G105 (= G100), E108 (= E103), P127 (= P122), E128 (= E123), T133 (≠ V128), P135 (= P130), G136 (= G131), K221 (≠ L216), F231 (= F226)
- binding octanoyl-coenzyme a: K25 (≠ R14), A26 (≠ Q15), L27 (≠ M16), A29 (= A18), A65 (= A54), A67 (= A56), D68 (= D57), I69 (= I58), K70 (≠ A59), G105 (= G100), E108 (= E103), P127 (= P122), E128 (= E123), G136 (= G131), A137 (= A132)
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
47% identity, 98% coverage: 5:247/249 of query aligns to 17:256/258 of 1mj3A
- active site: A68 (= A56), M73 (= M61), S83 (≠ K71), L85 (≠ T76), G109 (= G100), E112 (= E103), P131 (= P122), E132 (= E123), T137 (≠ V128), P139 (= P130), G140 (= G131), K225 (≠ L216), F235 (= F226)
- binding hexanoyl-coenzyme a: K26 (≠ R14), A27 (≠ Q15), L28 (≠ M16), A30 (= A18), A66 (= A54), G67 (= G55), A68 (= A56), D69 (= D57), I70 (= I58), G109 (= G100), P131 (= P122), E132 (= E123), L135 (= L126), G140 (= G131)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
43% identity, 99% coverage: 3:249/249 of query aligns to 12:259/259 of 5zaiC
- active site: A65 (= A56), F70 (≠ M61), S82 (≠ N73), R86 (= R77), G110 (= G100), E113 (= E103), P132 (= P122), E133 (= E123), I138 (≠ V128), P140 (= P130), G141 (= G131), A226 (≠ L216), F236 (= F226)
- binding coenzyme a: K24 (≠ Q15), L25 (≠ M16), A63 (= A54), G64 (= G55), A65 (= A56), D66 (= D57), I67 (= I58), P132 (= P122), R166 (≠ N156), F248 (= F238), K251 (≠ R241)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
36% identity, 99% coverage: 3:249/249 of query aligns to 13:261/261 of 5jbxB
- active site: A67 (= A56), R72 (vs. gap), L84 (≠ K71), R88 (≠ T76), G112 (= G100), E115 (= E103), T134 (≠ P122), E135 (= E123), I140 (≠ V128), P142 (= P130), G143 (= G131), A228 (≠ L216), L238 (≠ F226)
- binding coenzyme a: S24 (≠ R14), R25 (≠ Q15), R26 (≠ M16), A28 (= A18), A65 (= A54), D68 (= D57), L69 (≠ I58), K70 (≠ A59), L110 (= L98), G111 (= G99), T134 (≠ P122), E135 (= E123), L138 (= L126), R168 (≠ N156)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
35% identity, 98% coverage: 5:249/249 of query aligns to 13:257/257 of 6slbAAA
- active site: Q64 (≠ A56), F69 (≠ M61), L80 (≠ K71), N84 (≠ T76), A108 (≠ G100), S111 (≠ E103), A130 (≠ P122), F131 (≠ E123), L136 (≠ V128), P138 (= P130), D139 (≠ G131), A224 (≠ L216), G234 (≠ F226)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K50), A62 (= A54), Q64 (≠ A56), D65 (= D57), L66 (≠ I58), Y76 (= Y66), A108 (≠ G100), F131 (≠ E123), D139 (≠ G131)
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
34% identity, 98% coverage: 5:249/249 of query aligns to 10:245/245 of 6slaAAA
- active site: Q61 (≠ A56), L68 (≠ M61), N72 (≠ D65), A96 (≠ G100), S99 (≠ E103), A118 (≠ P122), F119 (≠ E123), L124 (≠ V128), P126 (= P130), N127 (≠ G131), A212 (≠ L216), G222 (≠ F226)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ M16), A59 (= A54), Q61 (≠ A56), D62 (= D57), L63 (≠ I58), L68 (≠ M61), Y71 (≠ W64), A94 (≠ L98), G95 (= G99), A96 (≠ G100), F119 (≠ E123), I122 (≠ L126), L124 (≠ V128), N127 (≠ G131), F234 (= F238), K237 (≠ R241)
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
32% identity, 98% coverage: 4:247/249 of query aligns to 20:266/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
33% identity, 98% coverage: 3:246/249 of query aligns to 18:268/275 of 4i52A
- active site: G77 (≠ A56), R82 (≠ M61), Y87 (= Y66), R95 (≠ K71), L99 (≠ I75), G123 (= G100), V126 (≠ E103), G146 (≠ E123), S151 (≠ V128), D153 (≠ P130), G154 (= G131), A240 (≠ F217), Y248 (≠ F226)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ R14), K30 (≠ Q15), R31 (≠ M16), A33 (= A18), S75 (≠ A54), G76 (= G55), G77 (≠ A56), D78 (= D57), Q79 (≠ I58), L96 (≠ S72), V98 (≠ Y74), Y119 (= Y96), I121 (≠ L98), G123 (= G100), T145 (≠ P122), V149 (≠ L126), S151 (≠ V128), F152 (≠ I129)
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
33% identity, 98% coverage: 3:246/249 of query aligns to 18:268/275 of 4i4zA
- active site: G77 (≠ A56), R82 (≠ M61), Y87 (= Y66), R95 (≠ K71), L99 (≠ I75), G123 (= G100), V126 (≠ E103), G146 (≠ E123), S151 (≠ V128), D153 (≠ P130), G154 (= G131), A240 (≠ F217), Y248 (≠ F226)
- binding Salicylyl CoA: H29 (≠ R14), K30 (≠ Q15), R31 (≠ M16), S75 (≠ A54), G76 (= G55), G77 (≠ A56), D78 (= D57), Q79 (≠ I58), Y87 (= Y66), V98 (≠ Y74), G123 (= G100), T145 (≠ P122), V149 (≠ L126), S151 (≠ V128), F260 (= F238), K263 (≠ R241)
- binding bicarbonate ion: G122 (= G99), Q144 (≠ L121), T145 (≠ P122), G146 (≠ E123), W174 (≠ C151)
3p85A Crystal structure enoyl-coa hydratase from mycobacterium avium (see paper)
36% identity, 86% coverage: 4:218/249 of query aligns to 10:210/224 of 3p85A
- active site: L62 (≠ A56), L67 (≠ M61), P68 (≠ R62), G92 (= G100), E95 (= E103), T114 (≠ P122), H115 (≠ E123), L120 (≠ V128), P122 (= P130), T123 (≠ G131), W208 (≠ L216)
- binding calcium ion: D43 (= D37), D45 (≠ G39)
Sites not aligning to the query:
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
33% identity, 98% coverage: 3:246/249 of query aligns to 18:254/261 of 4emlA
- active site: G77 (≠ A56), R81 (≠ A60), L85 (≠ W64), G109 (= G100), V112 (≠ E103), G132 (≠ E123), S137 (≠ V128), D139 (≠ P130), G140 (= G131), A226 (≠ F217), Y234 (≠ F226)
- binding bicarbonate ion: G108 (= G99), Q130 (≠ L121), G132 (≠ E123), W160 (≠ C151)
- binding chloride ion: D184 (≠ G175), R185 (= R176), E187 (≠ M178), E188 (≠ D179)
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
33% identity, 97% coverage: 5:246/249 of query aligns to 30:259/266 of 3h02A
- active site: G82 (≠ A56), H86 (≠ A60), L90 (≠ W64), G114 (= G100), V117 (≠ E103), G137 (≠ E123), S142 (≠ V128), D144 (≠ P130), G145 (= G131), A231 (vs. gap), Y239 (≠ F226)
- binding bicarbonate ion: G113 (= G99), Q135 (≠ L121), G137 (≠ E123), W165 (≠ C151)
Query Sequence
>RR42_RS23710 FitnessBrowser__Cup4G11:RR42_RS23710
MVGRVAVIRLNRPRQMNALNDALMDALGLALLACEQDDGVGAIVITGNDKAFAAGADIAA
MRGWDYMDVFKSNYITRNWETLRNVRKPVIAAVAGYALGGGCELAMACDILIAADNAVFG
LPELKLAVIPGAGGTQRLPRAISKAKAMDMCMTARNMDADEAERSGLVSRVVAAGRLMDE
AMAVAQTIAGFSLPSMMAVKEAINRACESSLSEGMLFERRQLHALFATEDLKEGMNAFLE
RRAAVFRHR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory