Comparing RR42_RS24120 FitnessBrowser__Cup4G11:RR42_RS24120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
58% identity, 91% coverage: 24:321/327 of query aligns to 1:298/305 of 4mncA
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
28% identity, 57% coverage: 121:306/327 of query aligns to 102:293/306 of 4xfeA
Sites not aligning to the query:
4pgpA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid (see paper)
21% identity, 68% coverage: 35:255/327 of query aligns to 11:233/308 of 4pgpA
Sites not aligning to the query:
4pgnA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate (see paper)
21% identity, 68% coverage: 35:255/327 of query aligns to 11:233/308 of 4pgnA
Sites not aligning to the query:
4napD Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan (see paper)
21% identity, 68% coverage: 35:255/327 of query aligns to 11:233/310 of 4napD
5i7iB Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
24% identity, 63% coverage: 47:253/327 of query aligns to 26:241/320 of 5i7iB
5izzA Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
23% identity, 63% coverage: 47:253/327 of query aligns to 24:239/318 of 5izzA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
22% identity, 86% coverage: 25:306/327 of query aligns to 3:298/304 of 4x8rA
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
19% identity, 74% coverage: 35:275/327 of query aligns to 12:250/319 of 4n6dA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
24% identity, 61% coverage: 47:244/327 of query aligns to 22:228/315 of 4pe3A
Sites not aligning to the query:
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
24% identity, 71% coverage: 25:255/327 of query aligns to 4:244/330 of 7ug8B
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
22% identity, 71% coverage: 29:259/327 of query aligns to 7:247/337 of 2hzlB
Sites not aligning to the query:
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
22% identity, 71% coverage: 29:259/327 of query aligns to 35:275/365 of Q3J1R2
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
30% identity, 43% coverage: 75:214/327 of query aligns to 54:203/329 of 4petA
Sites not aligning to the query:
>RR42_RS24120 FitnessBrowser__Cup4G11:RR42_RS24120
MSKLLKRLAATAVLGLLAVSAAAEEAQIRLATAFPENTSWVQELVKWSERVNSKGKGLVK
ISFIGGPRAIPTFEIGNAVKSGVVDMALSPGAFYTNVFPEADMLKMAQIPVSEQRKNGAI
EYINKVWNEKGNMVYLARMVEGYPFHIFLTQKIDKLDLTGKKIRVSPAIRPAVQALNGNV
INIPPGEIYTALERSVIDGYGWSIGGIFDLKIAPLTKFRVDPGFYDADVSLIMNLDKWKS
MTPQQRDFIQKMAMEIESNSSYWHKEGEDEKKKQNASGIQPLTFGAAETAKYLDAVYEAG
WADLIKTSPVHGPKLRALLSKEAMRKQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory