Comparing RR42_RS24170 FitnessBrowser__Cup4G11:RR42_RS24170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
40% identity, 99% coverage: 1:282/285 of query aligns to 1:260/264 of 6jvwB
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
39% identity, 78% coverage: 59:279/285 of query aligns to 44:244/252 of 3qdfA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 75% coverage: 69:283/285 of query aligns to 62:279/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 75% coverage: 69:283/285 of query aligns to 62:279/290 of 8gsrA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
34% identity, 96% coverage: 8:281/285 of query aligns to 7:274/279 of 6v77B
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
37% identity, 77% coverage: 59:278/285 of query aligns to 44:262/269 of 4dbhA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
34% identity, 77% coverage: 65:283/285 of query aligns to 78:301/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
34% identity, 77% coverage: 65:283/285 of query aligns to 79:302/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 76% coverage: 68:284/285 of query aligns to 59:276/277 of 6iymA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
35% identity, 71% coverage: 80:282/285 of query aligns to 15:214/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
35% identity, 71% coverage: 80:282/285 of query aligns to 20:219/224 of Q6P587
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
33% identity, 71% coverage: 80:282/285 of query aligns to 14:213/216 of 6sbiA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
33% identity, 81% coverage: 48:278/285 of query aligns to 34:256/265 of 3r6oA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 76% coverage: 59:276/285 of query aligns to 49:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
31% identity, 76% coverage: 59:276/285 of query aligns to 49:270/280 of 6j5xA
1gttA Crystal structure of hpce (see paper)
37% identity, 64% coverage: 78:260/285 of query aligns to 223:392/421 of 1gttA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
30% identity, 69% coverage: 86:282/285 of query aligns to 32:230/233 of 6j5yA
Sites not aligning to the query:
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
31% identity, 69% coverage: 78:273/285 of query aligns to 16:210/224 of 3v77A
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
31% identity, 66% coverage: 79:266/285 of query aligns to 10:216/247 of 1nkqA
2q1dX 2-keto-3-deoxy-d-arabinonate dehydratase complexed with magnesium and 2,5-dioxopentanoate (see paper)
30% identity, 58% coverage: 114:278/285 of query aligns to 105:272/281 of 2q1dX
Sites not aligning to the query:
>RR42_RS24170 FitnessBrowser__Cup4G11:RR42_RS24170
MKLCIFDDDRIGVALGQDVVDITDVFASSFRPTWPYPKYDWIINNFESVRPHIDEAIESG
RRVPLASVRLRAPVANPGKIIAAPINYKDHIAEANNDPQINHGKTFTDLSTLGVFLKANS
SVIGCHEDIRIPFPDRRTDHEVELAVVIGREAKKVSRENALAFVFGYCIGLDMTVRGPEL
PDFRKSADTFSVLGPWIVTADEIPEPNSLDLSIHVNGELRQQSNTKYLIYDVQRLIEYAS
AMYTLYPGDVIMTGTPAGVSPVTYGDILEASVSGIGTMTARVAAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory