SitesBLAST
Comparing RR42_RS24620 FitnessBrowser__Cup4G11:RR42_RS24620 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
38% identity, 88% coverage: 55:493/498 of query aligns to 4:449/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (≠ I60), G10 (= G61), G12 (= G63), A14 (= A65), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), T42 (= T94), G56 (= G109), Q57 (= Q110), W58 (= W111), V234 (= V280), V262 (≠ L309), W383 (= W427), W388 (= W433), C392 (= C437), Y393 (≠ T438), G420 (= G464), T421 (= T465), G429 (≠ T473), Y430 (≠ T474), I431 (≠ M475), A434 (= A478)
- binding magnesium ion: E125 (≠ R171), H188 (≠ N234)
P19643 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Rattus norvegicus (Rat) (see paper)
31% identity, 89% coverage: 56:496/498 of query aligns to 6:457/520 of P19643
- I199 (≠ L243) mutation to F: Increased affinity for serotonin and tyramine.
3rhaA The crystal structure of oxidoreductase from arthrobacter aurescens
32% identity, 88% coverage: 56:492/498 of query aligns to 7:449/459 of 3rhaA
- active site: S62 (≠ G113), S197 (≠ R241), K295 (= K342)
- binding dihydroflavine-adenine dinucleotide: V11 (≠ I60), G12 (= G61), G14 (= G63), P15 (≠ L64), S16 (≠ A65), E35 (= E85), A36 (= A86), R37 (= R87), G42 (= G92), R43 (= R93), G57 (= G108), G58 (= G109), Q59 (= Q110), W60 (= W111), P234 (= P279), V235 (= V280), V263 (≠ L309), W384 (= W427), W389 (≠ N432), Y394 (≠ C437), S421 (≠ G464), S422 (≠ T465), Q430 (≠ T473), H431 (≠ T474), V432 (≠ M475)
P56560 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Bos taurus (Bovine) (see paper)
31% identity, 87% coverage: 64:496/498 of query aligns to 14:457/520 of P56560
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
2yg4A Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine (see paper)
31% identity, 87% coverage: 56:486/498 of query aligns to 6:443/449 of 2yg4A
- active site: S61 (≠ G113), S196 (≠ Y240), K295 (= K342)
- binding 4-hydroxybutan-1-aminium: G171 (≠ Q214), E323 (≠ W370), Y394 (≠ C437)
- binding flavin-adenine dinucleotide: V10 (≠ I60), G11 (= G61), G13 (= G63), P14 (≠ L64), S15 (≠ A65), E34 (= E85), A35 (= A86), R36 (= R87), G41 (= G92), R42 (= R93), G56 (= G108), G57 (= G109), Q58 (= Q110), W59 (= W111), V234 (= V280), V263 (≠ L309), W384 (= W427), W389 (≠ N432), Y394 (≠ C437), C421 (≠ G464), S422 (≠ T465), Q430 (≠ T473), H431 (≠ T474), V432 (≠ M475)
2yg3B Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme (see paper)
31% identity, 87% coverage: 56:486/498 of query aligns to 6:443/450 of 2yg3B
- active site: S61 (≠ G113), S196 (≠ Y240), K295 (= K342)
- binding flavin-adenine dinucleotide: V10 (≠ I60), G11 (= G61), G13 (= G63), P14 (≠ L64), S15 (≠ A65), E34 (= E85), A35 (= A86), R36 (= R87), G41 (= G92), R42 (= R93), G56 (= G108), G57 (= G109), Q58 (= Q110), W59 (= W111), V234 (= V280), V263 (≠ L309), W384 (= W427), W389 (≠ N432), Y394 (≠ C437), C421 (≠ G464), S422 (≠ T465), Q430 (≠ T473), H431 (≠ T474), V432 (≠ M475), A435 (= A478)
7b0zA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 13:456/498 of 7b0zA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ A197), W156 (≠ L201)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), P233 (= P279), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (vs. gap), G424 (= G464), T425 (= T465), G433 (≠ T473), Y434 (≠ T474), M435 (= M475)
- binding (E)-3-phenyl-1-(4-(trifluoromethyl)phenyl)prop-2-en-1-one: Y59 (≠ W111), L170 (= L215), C171 (≠ T216), I198 (≠ L243), Q205 (= Q251), I315 (≠ V362), Y325 (≠ W370), Y397 (vs. gap), Y434 (≠ T474)
Sites not aligning to the query:
7b0vA Crystal structure of human monoamine oxidase b in complex with (e)-3- phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 13:456/498 of 7b0vA
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ A197), K153 (≠ T198), W156 (≠ L201)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (vs. gap), G424 (= G464), T425 (= T465), G433 (≠ T473), Y434 (≠ T474), M435 (= M475)
- binding (E)-3-phenyl-1-(3-(trifluoromethyl)phenyl)prop-2-en-1-one: W118 (≠ R163), F167 (≠ A212), L170 (= L215), C171 (≠ T216), I198 (≠ L243), Q205 (= Q251), I315 (≠ V362), Y325 (≠ W370)
Sites not aligning to the query:
7p4hA Crystal structure of monoamine oxidase b in complex with inhibitor (+)-2 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 7p4hA
- binding 3,4-dimethyl-7-[[(3~{S})-piperidin-3-yl]methoxy]chromen-2-one: Y58 (≠ W111), L169 (= L215), C170 (≠ T216), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
Sites not aligning to the query:
7p4fA Crystal structure of monoamine oxidase b in complex with inhibitor 1 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 7p4fA
- binding 4-(hydroxymethyl)-7-[[4-[[methyl-(phenylmethyl)amino]methyl]phenyl]methoxy]chromen-2-one: Y58 (≠ W111), F101 (≠ A146), W117 (≠ R163), L162 (≠ G208), F166 (≠ A212), L169 (= L215), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), F341 (= F387), Y396 (vs. gap), Y433 (≠ T474)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), K152 (≠ T198), W155 (≠ L201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), T41 (= T94), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
Sites not aligning to the query:
6rleA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 97 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 6rleA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), W155 (≠ L201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding 4-[2-(4-propan-2-ylphenyl)ethyl]-1-[(~{E})-prop-1-enyl]piperidine: F166 (≠ A212), L169 (= L215), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), Y396 (vs. gap)
Sites not aligning to the query:
6rkpA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 84 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 6rkpA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), W155 (≠ L201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding 1-[(~{E})-prop-1-enyl]-4-[(~{E})-2-[4-(trifluoromethyl)phenyl]ethenyl]piperidine: P102 (≠ R147), L169 (= L215), I197 (≠ L243), Q204 (= Q251), I314 (≠ V362), Y324 (≠ W370), F341 (= F387), Y396 (vs. gap)
Sites not aligning to the query:
6rkbA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 1 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 6rkbA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), K152 (≠ T198)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding 4-[(~{E})-2-(4-fluorophenyl)ethenyl]-1-[(~{E})-prop-1-enyl]piperidine: L169 (= L215), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), Y396 (vs. gap)
Sites not aligning to the query:
6fwcA Crystal structure of human monoamine oxidase b (mao b) in complex with fluorophenyl-chromone-carboxamide (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 6fwcA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), K152 (≠ T198), W155 (≠ L201)
- binding ~{N}-(3-fluorophenyl)-4-oxidanylidene-chromene-3-carboxamide: L169 (= L215), C170 (≠ T216), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), F341 (= F387), Y396 (vs. gap)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
Sites not aligning to the query:
5mrlA Crystal structure of human monoamine oxidase b (mao b) in complex with n(furan2ylmethyl)nmethylprop2yn1amine (f2mpa) (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 5mrlA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding (~{E})-~{N}-(furan-2-ylmethyl)-~{N}-methyl-prop-1-en-1-amine: L169 (= L215), Q204 (= Q251), Y396 (vs. gap)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
Sites not aligning to the query:
4crtA Crystal structure of human monoamine oxidase b in complex with the multi-target inhibitor ass234 (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 4crtA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding (E)-N-methyl-N-[[1-methyl-5-[3-[1-(phenylmethyl)piperidin-4-yl]propoxy]indol-2-yl]methyl]prop-1-en-1-amine: L169 (= L215), C170 (≠ T216), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), Y396 (vs. gap)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
Sites not aligning to the query:
4a7aA Crystal structure of human monoamine oxidase b (mao b) in complex with rosiglitazone (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 4a7aA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding (r)-rosiglitazone: L169 (= L215), I196 (≠ Q242), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), F341 (= F387)
Sites not aligning to the query:
4a79A Crystal structure of human monoamine oxidase b (mao b) in complex with pioglitazone (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 4a79A
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding (5R)-5-{4-[2-(5-ethylpyridin-2-yl)ethoxy]benzyl}-1,3-thiazolidine-2,4-dione: Y58 (≠ W111), F101 (≠ A146), P102 (≠ R147), W117 (≠ R163), L169 (= L215), I196 (≠ Q242), I197 (≠ L243), Q204 (= Q251), I314 (≠ V362), Y324 (≠ W370), F341 (= F387)
Sites not aligning to the query:
3po7A Human monoamine oxidase b in complex with zonisamide (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 3po7A
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding 1-(1,2-benzoxazol-3-yl)methanesulfonamide: Y58 (≠ W111), L169 (= L215), C170 (≠ T216), I197 (≠ L243), Q204 (= Q251), Y324 (≠ W370), F341 (= F387), Y396 (vs. gap), Y433 (≠ T474)
Sites not aligning to the query:
2xcgA Tranylcypromine-inhibited human monoamine oxidase b in complex with 2- (2-benzofuranyl)-2-imidazoline (see paper)
30% identity, 87% coverage: 64:496/498 of query aligns to 12:455/499 of 2xcgA
- active site: G60 (= G113), R195 (= R241), K294 (≠ R341)
- binding 3-phenylpropanal: Q204 (= Q251), Y396 (vs. gap), Y433 (≠ T474)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ A197), K152 (≠ T198), W155 (≠ L201)
- binding [[(2r,3s,4s)-5-[(4as)-7,8-dimethyl-2,4-dioxo-4a,5-dihydrobenzo[g]pteridin-10-yl]-2,3,4-trihydroxy-pentoxy]-hydroxy-phosphoryl] [(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxy-oxolan-2-yl]methyl hydrogen phosphate: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (vs. gap), G423 (= G464), T424 (= T465), G432 (≠ T473), Y433 (≠ T474), M434 (= M475)
- binding 2-(2-benzofuranyl)-2-imidazoline: L86 (vs. gap), P100 (≠ N145), F166 (≠ A212), I197 (≠ L243), I314 (≠ V362), Y324 (≠ W370)
Sites not aligning to the query:
- binding [[(2r,3s,4s)-5-[(4as)-7,8-dimethyl-2,4-dioxo-4a,5-dihydrobenzo[g]pteridin-10-yl]-2,3,4-trihydroxy-pentoxy]-hydroxy-phosphoryl] [(2r,3s,4r,5r)-5-(6-aminopurin-9-yl)-3,4-dihydroxy-oxolan-2-yl]methyl hydrogen phosphate: 8, 9, 11
Query Sequence
>RR42_RS24620 FitnessBrowser__Cup4G11:RR42_RS24620
MDDIAKKHDEAPEAAALTRRGFLGMAASVTAVATAAVLPNVAGAVSAAGDERDVLEVAII
GAGLAGLTAARDLKRAGCESFVVLEARDRVGGRTLNHDLGNGYFSEAGGQWIGPGQTAVA
DLARELGVGSFLTYWEGKAVMLAGNARATIAIDGGFDTDPKLRRELEEMARSVPTAAPWT
SPRAAEFDAMSLADWLATKHLTPEDQIGWALAAQLTTGTAPEKLSMLHYLSLINSAECNY
RQLEAVKGGAQESRIAGGSQILSIKMAEALGDKVRLSTPVLRIENWQNGPVTLHTAKGVI
RARSLIVALSPSLCNQITFDPPLPEKRREMQRRWPAYAPMRKTAHVYKKAFWRDKGLNGM
VVQLKGPVQWAFDNSPEDVSFGVISAFANNGVLPSDPKAAEAELSRIYAQAFGDEALHPV
AYHEHDWGKADNWSLSCTSPIPPGFLTKYGDVLHPSIGRLIWAGTETAEIWITTMDGAIR
SGHKAALQALQAVAELKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory