Comparing RR42_RS24800 FitnessBrowser__Cup4G11:RR42_RS24800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
35% identity, 71% coverage: 17:137/171 of query aligns to 530:658/678 of 6jqoA
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
35% identity, 71% coverage: 17:137/171 of query aligns to 530:658/678 of 6jqnA
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
35% identity, 71% coverage: 17:137/171 of query aligns to 530:658/678 of 6jqmA
Sites not aligning to the query:
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
35% identity, 71% coverage: 17:137/171 of query aligns to 531:659/681 of P77455
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
29% identity, 77% coverage: 20:150/171 of query aligns to 23:150/165 of A0A3Q7HWE4
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
29% identity, 49% coverage: 31:114/171 of query aligns to 46:130/168 of P86397
Sites not aligning to the query:
>RR42_RS24800 FitnessBrowser__Cup4G11:RR42_RS24800
MSDTSKRIINNRIDQTFDELQIGQVFRSGGRTVTEADVVNYCALTGNWIEIHSNTHYASK
TRFGQRLVQGSLTYSIVTGLIQFGLGIQANYGIDNMRFRNPVYINDTIYAVCEVIGKKEK
DEKYGVIKFRISAINQNGDLLQQGEWSLLMLRKRDDLDALIASSLPELKAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory