SitesBLAST
Comparing RR42_RS24995 FitnessBrowser__Cup4G11:RR42_RS24995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
44% identity, 96% coverage: 12:259/259 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), G16 (= G25), I17 (= I26), D36 (= D45), L37 (≠ R46), C61 (≠ T69), D62 (= D70), V63 (≠ I71), N89 (= N97), A90 (= A98), T140 (≠ C148), S142 (= S150), Y155 (= Y163), K159 (= K167), A186 (≠ S194), V187 (≠ S195)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
39% identity, 96% coverage: 12:259/259 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G25), S142 (= S150), Y155 (= Y163), K159 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), S15 (= S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (vs. gap), A61 (≠ T69), D62 (= D70), T63 (≠ I71), N89 (= N97), A90 (= A98), M140 (≠ C148), S142 (= S150), Y155 (= Y163), K159 (= K167), P185 (= P193), A186 (≠ S194), Y187 (≠ S195), I188 (≠ T196), L192 (≠ M200)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 95% coverage: 12:258/259 of query aligns to 3:247/248 of 4urfB
- active site: G16 (= G25), S142 (= S150), I152 (≠ A160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (= L221), R211 (≠ G222), R212 (= R223)
- binding bicarbonate ion: I92 (≠ V100), G94 (≠ N102), R109 (= R117), R179 (= R187), S228 (= S239)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), G14 (≠ A23), N15 (≠ S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (≠ R46), D62 (= D70), T63 (≠ I71), N89 (= N97), A90 (= A98), G91 (= G99), I140 (≠ C148), Y155 (= Y163), K159 (= K167), P185 (= P193), A186 (≠ S194), I188 (≠ T196), T190 (= T198)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 95% coverage: 12:258/259 of query aligns to 3:247/248 of 4urfA
- active site: G16 (= G25), S142 (= S150), I152 (≠ A160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ V100), S93 (≠ P101), G94 (≠ N102), E95 (≠ A103), T97 (≠ K105), E101 (= E109), T103 (= T111), Q106 (≠ D114), R109 (= R117), S175 (≠ L183), G177 (≠ N185)
- binding magnesium ion: S237 (≠ V248), Y238 (≠ T249)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), G14 (≠ A23), N15 (≠ S24), G16 (= G25), I17 (= I26), D36 (= D45), I37 (≠ R46), W41 (≠ G50), D62 (= D70), T63 (≠ I71), N89 (= N97), A90 (= A98), G91 (= G99), I140 (≠ C148), Y155 (= Y163), K159 (= K167), P185 (= P193), I188 (≠ T196), T190 (= T198)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
39% identity, 95% coverage: 12:258/259 of query aligns to 3:247/248 of 4ureB
- active site: G16 (= G25), S142 (= S150), I152 (≠ A160), Y155 (= Y163), K159 (= K167)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S24), G16 (= G25), I17 (= I26), N89 (= N97), G91 (= G99), Y155 (= Y163), P185 (= P193), A186 (≠ S194)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
44% identity, 94% coverage: 12:255/259 of query aligns to 3:249/254 of 3toxA
- active site: G16 (= G25), S142 (= S150), V153 (≠ A160), Y156 (= Y163), K160 (= K167)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G21), S14 (≠ A23), S15 (= S24), G16 (= G25), I17 (= I26), A36 (≠ D45), R37 (= R46), N38 (= N49), V63 (≠ I71), N89 (= N97), A90 (= A98), G91 (= G99), T140 (≠ C148), S142 (= S150), Y156 (= Y163), K160 (= K167), P186 (= P193), G188 (≠ S195), T189 (= T196), T191 (= T198)
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 95% coverage: 12:258/259 of query aligns to 3:243/251 of 6vspA
- active site: G16 (= G25), S138 (= S150), Y151 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), N15 (≠ S24), G16 (= G25), M17 (≠ I26), D36 (= D45), W37 (≠ L53), W37 (≠ L53), A38 (= A54), I59 (≠ T69), D60 (= D70), V61 (≠ I71), N87 (= N97), A88 (= A98), G89 (= G99), V90 (= V100), V110 (= V121), T136 (≠ C148), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (= P193), S182 (= S194), L183 (≠ S195), V184 (≠ T196), T186 (= T198), N187 (≠ P199), M188 (= M200), T189 (≠ Y201)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
38% identity, 95% coverage: 12:258/259 of query aligns to 5:245/252 of 6vspB
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
38% identity, 95% coverage: 12:258/259 of query aligns to 3:243/251 of 6xewA
- active site: G16 (= G25), S138 (= S150), Y151 (= Y163)
- binding r,3-hydroxybutan-2-one: S138 (= S150), S140 (≠ H152), Y151 (= Y163)
- binding s,3-hydroxybutan-2-one: S138 (= S150), Y151 (= Y163), S182 (= S194)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), N15 (≠ S24), G16 (= G25), M17 (≠ I26), D36 (= D45), W37 (≠ L53), W37 (≠ L53), A38 (= A54), I59 (≠ T69), D60 (= D70), V61 (≠ I71), N87 (= N97), A88 (= A98), G89 (= G99), V110 (= V121), T136 (≠ C148), S138 (= S150), Y151 (= Y163), K155 (= K167), S182 (= S194), L183 (≠ S195), V184 (≠ T196), T186 (= T198), N187 (≠ P199), M188 (= M200), T189 (≠ Y201)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
38% identity, 95% coverage: 12:258/259 of query aligns to 3:243/251 of H9XP47
- N15 (≠ S24) binding
- M17 (≠ I26) binding
- D36 (= D45) binding
- D60 (= D70) binding
- V61 (≠ I71) binding
- N87 (= N97) binding
- S138 (= S150) binding ; binding
- V139 (≠ I151) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ H152) binding
- Y151 (= Y163) binding ; binding ; binding
- K155 (= K167) binding
- V184 (≠ T196) binding
- T186 (= T198) binding
- RDK 197:199 (≠ PDH 209:211) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
2hsdA The refined three-dimensional structure of 3alpha,20beta- hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases (see paper)
41% identity, 96% coverage: 10:257/259 of query aligns to 1:242/253 of 2hsdA
- active site: G16 (= G25), S138 (= S150), Y151 (= Y163), K155 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), R15 (≠ S24), G16 (= G25), L17 (≠ I26), D36 (= D45), V37 (vs. gap), L58 (≠ T69), V60 (≠ I71), N86 (= N97), A87 (= A98), S138 (= S150), Y151 (= Y163), K155 (= K167), P181 (= P193), G182 (≠ S194), T184 (= T196)
1hdcA Mechanism of inhibition of 3alpha,20beta-hydroxysteroid dehydrogenase by a licorice-derived steroidal inhibitor (see paper)
41% identity, 96% coverage: 10:257/259 of query aligns to 1:242/253 of 1hdcA
- active site: G16 (= G25), S138 (= S150), Y151 (= Y163), K155 (= K167)
- binding carbenoxolone: S90 (≠ N102), T91 (≠ A103), G92 (= G104), L147 (≠ R159), Y151 (= Y163), M183 (≠ S195), M188 (= M200), T189 (≠ Y204), T192 (= T207)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
37% identity, 95% coverage: 12:258/259 of query aligns to 8:252/258 of 4wecA
- active site: G21 (= G25), S143 (= S150), Q154 (≠ A161), Y157 (= Y163), K161 (= K167)
- binding nicotinamide-adenine-dinucleotide: G17 (= G21), A19 (= A23), S20 (= S24), G21 (= G25), I22 (= I26), D41 (= D45), I42 (vs. gap), V61 (≠ T69), D62 (= D70), V63 (≠ I71), N89 (= N97), T141 (≠ C148), Y157 (= Y163), K161 (= K167), P187 (= P193), P189 (≠ S195), V190 (≠ T196)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 95% coverage: 14:258/259 of query aligns to 5:238/240 of 2d1yA
- active site: G16 (= G25), S135 (= S150), N145 (≠ A160), Y148 (= Y163), K152 (= K167)
- binding nicotinamide-adenine-dinucleotide: G12 (= G21), R15 (≠ S24), I17 (= I26), D36 (= D45), L37 (≠ R46), R38 (≠ G47), V55 (≠ T69), D56 (= D70), L57 (≠ I71), N83 (= N97), A84 (= A98), A85 (≠ G99), I86 (≠ V100), V133 (≠ C148), S135 (= S150), Y148 (= Y163), K152 (= K167), P178 (= P193), G179 (≠ S194), I181 (≠ T196), T183 (= T198), A185 (≠ M200), V186 (≠ Y201)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 97% coverage: 9:258/259 of query aligns to 2:254/255 of 5itvA
- active site: G18 (= G25), S141 (= S150), Y154 (= Y163), K158 (= K167)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G21), S17 (= S24), G18 (= G25), I19 (= I26), D38 (= D45), I39 (vs. gap), T61 (= T69), I63 (= I71), N89 (= N97), G91 (= G99), T139 (≠ C148), S141 (= S150), Y154 (= Y163), K158 (= K167), P184 (= P193), G185 (≠ S194), I186 (≠ S195), I187 (≠ T196)
A0A3Q8GLE8 (+)-cis,cis-nepetalactol synthase NEPS3; Nepetalactol-related short-chain reductase 3; NmNEPS3; EC 5.5.1.35 from Nepeta racemosa (Catmint) (Raceme catnip) (see paper)
36% identity, 98% coverage: 1:255/259 of query aligns to 1:259/270 of A0A3Q8GLE8
- 21:27 (vs. 21:27, 100% identical) binding
- DIQ 46:48 (≠ DRG 45:47) binding
- DV 70:71 (≠ DI 70:71) binding
- N97 (= N97) binding
- N150 (≠ S149) mutation to T: No effect on catalytic activity.
- S154 (≠ G153) mutation to L: Abolishes catalytic activity.
- YVMSK 165:169 (≠ YTASK 163:167) binding
- K169 (= K167) mutation to M: Abolishes catalytic activity.
- M196 (≠ S194) mutation to S: Abolishes catalytic activity.
- VATPL 198:202 (≠ TRTPM 196:200) binding
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
33% identity, 95% coverage: 12:257/259 of query aligns to 3:257/267 of F1SWA0
- S142 (= S150) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ H152) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y163) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K167) mutation to A: Abolishes all oxidoreductase activity.
6f9qC Binary complex of a 7s-cis-cis-nepetalactol cyclase from nepeta mussinii with NAD+ (see paper)
37% identity, 94% coverage: 12:255/259 of query aligns to 6:253/260 of 6f9qC
- active site: G19 (= G25), Y159 (= Y163)
- binding nicotinamide-adenine-dinucleotide: G15 (= G21), S18 (= S24), G19 (= G25), I20 (= I26), D40 (= D45), I41 (≠ R46), Q42 (≠ G47), C63 (≠ T69), D64 (= D70), V65 (≠ I71), N91 (= N97), A92 (= A98), G93 (= G99), N144 (≠ S149), Y159 (= Y163), K163 (= K167), P189 (= P193), M190 (≠ S194), V192 (≠ T196), T194 (= T198), P195 (= P199), L196 (≠ M200), T197 (≠ Y201)
1iy8A Crystal structure of levodione reductase (see paper)
35% identity, 94% coverage: 15:258/259 of query aligns to 5:256/258 of 1iy8A
- active site: G15 (= G25), S143 (= S150), Q153 (≠ A160), Y156 (= Y163), K160 (= K167)
- binding nicotinamide-adenine-dinucleotide: G11 (= G21), S14 (= S24), G15 (= G25), L16 (≠ I26), D35 (= D45), V36 (≠ R46), A62 (vs. gap), D63 (= D70), V64 (≠ I71), N90 (= N97), G92 (= G99), I93 (≠ V100), T141 (≠ C148), S143 (= S150), Y156 (= Y163), K160 (= K167), P186 (= P193), G187 (≠ S194), T191 (= T198), P192 (= P199), M193 (= M200)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
35% identity, 94% coverage: 15:258/259 of query aligns to 14:265/267 of Q9LBG2
- 17:42 (vs. 18:43, 54% identical) binding
- E103 (≠ P101) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Query Sequence
>RR42_RS24995 FitnessBrowser__Cup4G11:RR42_RS24995
MGINGINGINGIEGKSIIVTGGASGIGEAAARLLAANGALLTIADRGSNGAALAKELTDQ
GLRAQFVETDISSEADVIAMVEAAVRSYGRLDRAFNNAGVPNAGKLLAELTEEDFRRCHD
VNVIGTFLCMKHEILAMLKTGGGAIVNCSSIHGLIYTARAAEYTASKHAITGMTKAAAAD
YGLQNIRVNAIAPSSTRTPMYLHYLKTKPDHEERVNGLHLLGRASEPIEQAQAAMWLLSD
AASFVTGVTLPVDGGYTAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory