Comparing RR42_RS25095 FitnessBrowser__Cup4G11:RR42_RS25095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
5ugrA Malyl-coa lyase from methylobacterium extorquens (see paper)
30% identity, 96% coverage: 10:294/296 of query aligns to 14:320/323 of 5ugrA
4l9yA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
28% identity, 97% coverage: 7:292/296 of query aligns to 11:313/314 of 4l9yA
Q3J5L6 L-malyl-CoA/beta-methylmalyl-CoA lyase; (3S)-malyl-CoA/beta-methylmalyl-CoA lyase; (S)-citramalyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
28% identity, 97% coverage: 7:292/296 of query aligns to 12:314/318 of Q3J5L6
4l9yC Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, glyoxylate, and propionyl-coa (see paper)
28% identity, 97% coverage: 7:292/296 of query aligns to 11:313/316 of 4l9yC
4l9zA Crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa (see paper)
28% identity, 97% coverage: 7:292/296 of query aligns to 10:312/313 of 4l9zA
Q9RUZ0 Citrate lyase subunit beta-like protein; EC 4.1.-.- from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
29% identity, 95% coverage: 9:288/296 of query aligns to 8:280/284 of Q9RUZ0
Q8N0X4 Citramalyl-CoA lyase, mitochondrial; (3S)-malyl-CoA thioesterase; Beta-methylmalate synthase; Citrate lyase subunit beta-like protein; Citrate lyase beta-like; Malate synthase; EC 4.1.3.25; EC 3.1.2.30; EC 2.3.3.-; EC 2.3.3.9 from Homo sapiens (Human) (see 5 papers)
27% identity, 97% coverage: 8:293/296 of query aligns to 44:336/340 of Q8N0X4
Sites not aligning to the query:
5vxoA Crystal structure analysis of human clybl in complex with propionyl- coa (see paper)
27% identity, 97% coverage: 8:293/296 of query aligns to 5:297/298 of 5vxoA
5vxcA Crystal structure analysis of human clybl in complex with free coash (see paper)
27% identity, 97% coverage: 8:293/296 of query aligns to 5:297/301 of 5vxcA
1sgjB Crystal structure of citrate lyase beta subunit
30% identity, 79% coverage: 9:242/296 of query aligns to 5:231/231 of 1sgjB
1sgjA Crystal structure of citrate lyase beta subunit
30% identity, 79% coverage: 9:242/296 of query aligns to 5:231/231 of 1sgjA
S5N020 Malyl-CoA/beta-methylmalyl-CoA/citramalyl-CoA lyase; (3S)-3-carboxy-3-hydroxypropanoyl-CoA glyoxylate-lyase; (3S)-citramalyl-CoA pyruvate-lyase; (S)-citramalyl-CoA lyase; Erythro-beta-methylmalyl-CoA; L-malyl-CoA lyase; EC 4.1.3.24; EC 4.1.3.25 from Chloroflexus aurantiacus (see paper)
28% identity, 97% coverage: 6:292/296 of query aligns to 25:333/348 of S5N020
4l80C Crystal structure of chloroflexus aurantiacus malyl-coa lyase in complex with magnesium, oxalate, and propionyl-coa (see paper)
28% identity, 97% coverage: 6:292/296 of query aligns to 24:332/347 of 4l80C
6aq4C Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
27% identity, 96% coverage: 1:283/296 of query aligns to 1:262/267 of 6aq4C
6aq4B Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and citramalyl-coa (see paper)
27% identity, 96% coverage: 1:283/296 of query aligns to 1:262/268 of 6aq4B
6as5A Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, acetoacetate and coenzyme a (see paper)
27% identity, 92% coverage: 13:283/296 of query aligns to 9:260/267 of 6as5A
6arbA Crystal structure of protein cite from mycobacterium tuberculosis in complex with magnesium, pyruvate and coenzyme a (see paper)
27% identity, 92% coverage: 13:283/296 of query aligns to 10:261/268 of 6arbA
1u5vA Structure of cite complexed with triphosphate group of atp form mycobacterium tuberculosis
27% identity, 71% coverage: 34:242/296 of query aligns to 31:222/223 of 1u5vA
>RR42_RS25095 FitnessBrowser__Cup4G11:RR42_RS25095
MSVSAMKPMRSMMFVPGNKPDWIEKSVAAKADALILDLEDSVPPAQKVEAREIVKSKLDW
LAGQKPRIWVRINRSAHLYDYEDILAIVNPVVEGIVISKPCGPEDIHTVSSMLAEAEYRA
GVPVGHTRVIPLLETARSLQYAYEIAQHERVPAIVGATAKNADVARALKTVWSLEGRETL
YLKSRIVMAARAAGKLPIGGVWQQVHDLEGLKVSSANDRQLGMSGELVLHPSNVEIVNKT
YSPTEEEVAFYQGMIDALEKAQAEGRASCIYDGEHIDIAHVKTAREIIELAQSFNN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory