SitesBLAST
Comparing RR42_RS25125 FitnessBrowser__Cup4G11:RR42_RS25125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
49% identity, 98% coverage: 3:247/249 of query aligns to 1:243/248 of Q9KJF1
- M1 (≠ L3) modified: Initiator methionine, Removed
- S15 (≠ R17) binding
- D36 (= D38) binding
- D62 (= D64) binding
- I63 (= I65) binding
- N89 (= N91) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
49% identity, 98% coverage: 5:247/249 of query aligns to 2:242/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ L19), D35 (= D38), I36 (≠ V39), I62 (= I65), N88 (= N91), G90 (= G93), I138 (= I141), S140 (= S143), Y152 (= Y155), K156 (= K159), I185 (= I188)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
44% identity, 97% coverage: 8:248/249 of query aligns to 5:245/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
43% identity, 97% coverage: 8:248/249 of query aligns to 2:238/239 of 3sj7A
- active site: G12 (= G18), S138 (= S143), Q148 (= Q152), Y151 (= Y155), K155 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), S10 (≠ A16), R11 (= R17), I13 (≠ L19), N31 (≠ T37), Y32 (≠ D38), A33 (≠ V39), G34 (vs. gap), S35 (≠ L40), A58 (= A63), N59 (≠ D64), V60 (≠ I65), N86 (= N91), A87 (= A92), T109 (≠ V114), S138 (= S143), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
43% identity, 97% coverage: 8:248/249 of query aligns to 6:242/244 of 6wprA
- active site: G16 (= G18), S138 (= S143), Y151 (= Y155)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (= R17), T37 (≠ V39), L58 (≠ A63), D59 (= D64), V60 (≠ I65), N86 (= N91), A87 (= A92), G88 (= G93), I89 (≠ F94), I136 (= I141), Y151 (= Y155), K155 (= K159), P181 (= P185)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
43% identity, 97% coverage: 8:248/249 of query aligns to 6:242/244 of 6t62A
- active site: G16 (= G18), S138 (= S143), Y151 (= Y155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (= R17), A36 (≠ D38), T37 (≠ V39), L58 (≠ A63), D59 (= D64), V60 (≠ I65), N86 (= N91), A87 (= A92), G88 (= G93), I89 (≠ F94), I136 (= I141), S137 (= S142), S138 (= S143), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), I184 (= I188), M188 (= M192)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
44% identity, 98% coverage: 4:246/249 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (≠ M115), S139 (= S143), Q149 (= Q152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (= D97), K98 (= K102), S139 (= S143), N146 (= N149), V147 (≠ P150), Q149 (= Q152), Y152 (= Y155), F184 (= F187), M189 (= M192), K200 (≠ R205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ R17), G18 (= G18), I19 (≠ L19), D38 (= D38), F39 (≠ V39), V59 (≠ A63), D60 (= D64), V61 (≠ I65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ F94), T137 (≠ I141), S139 (= S143), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (= F187), T185 (≠ I188), T187 (= T190), M189 (= M192)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
44% identity, 98% coverage: 3:246/249 of query aligns to 4:244/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (= R17), G19 (= G18), I20 (≠ L19), D39 (= D38), R40 (≠ L40), C63 (≠ A63), I65 (= I65), N91 (= N91), G93 (= G93), I94 (≠ F94), V114 (= V114), Y155 (= Y155), K159 (= K159), I188 (= I188), T190 (= T190), T193 (≠ V193)
4nbwA Crystal structure of fabg from plesiocystis pacifica (see paper)
48% identity, 96% coverage: 8:246/249 of query aligns to 2:248/253 of 4nbwA
- active site: G12 (= G18), S146 (= S143), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), N11 (≠ R17), G12 (= G18), I13 (≠ L19), D32 (= D38), L33 (≠ V39), V57 (≠ A63), D58 (= D64), V59 (≠ I65), N85 (= N91), A86 (= A92), G87 (= G93), S146 (= S143), Y159 (= Y155), K163 (= K159), I192 (= I188), T194 (= T190)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
42% identity, 99% coverage: 3:248/249 of query aligns to 4:245/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (= R17), I20 (≠ L19), T40 (≠ L40), N62 (≠ D64), V63 (≠ I65), N89 (= N91), A90 (= A92), I92 (≠ F94), V139 (≠ I141), S141 (= S143), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), I187 (= I188), T189 (= T190), M191 (= M192)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
43% identity, 99% coverage: 3:248/249 of query aligns to 1:242/244 of 6t77A
- active site: G16 (= G18), S138 (= S143), Y151 (= Y155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (= R17), T37 (≠ V39), L58 (≠ A63), N59 (≠ D64), V60 (≠ I65), A87 (= A92), G88 (= G93), I89 (≠ F94)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
43% identity, 98% coverage: 3:246/249 of query aligns to 1:244/247 of 4jroC
- active site: G16 (= G18), S142 (= S143), Q152 (= Q152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G14), S14 (≠ A16), R15 (= R17), G16 (= G18), I17 (≠ L19), N35 (≠ T37), Y36 (vs. gap), N37 (≠ D38), G38 (≠ V39), S39 (≠ L40), N63 (≠ D64), V64 (≠ I65), N90 (= N91), A91 (= A92), I93 (≠ F94), I113 (≠ V114), S142 (= S143), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (= I188), T190 (= T190)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
43% identity, 98% coverage: 4:248/249 of query aligns to 5:250/251 of 4cqlI
- active site: G19 (= G18), S146 (= S143), Y159 (= Y155), K163 (= K159)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ R17), G19 (= G18), I20 (≠ L19), D39 (= D38), L40 (≠ V39), A64 (= A63), D65 (= D64), V66 (≠ I65), C93 (≠ N91), A94 (= A92), G95 (= G93), I96 (≠ F94), V116 (= V114), I144 (= I141), S146 (= S143), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), I192 (= I188), T194 (= T190), M196 (= M192)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
45% identity, 96% coverage: 8:246/249 of query aligns to 7:243/247 of P73574
- A14 (≠ S15) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P150) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K159) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F187) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ P197) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
43% identity, 99% coverage: 3:248/249 of query aligns to 1:242/244 of P0AEK2
- GASR 12:15 (≠ GSAR 14:17) binding
- T37 (≠ V39) binding
- NV 59:60 (≠ DI 64:65) binding
- N86 (= N91) binding
- Y151 (= Y155) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 155:159) binding
- A154 (= A158) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K159) mutation to A: Defect in the affinity for NADPH.
- I184 (= I188) binding
- E233 (= E239) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
43% identity, 98% coverage: 4:248/249 of query aligns to 1:241/243 of 1q7bA
- active site: G15 (= G18), E101 (≠ D107), S137 (= S143), Q147 (= Q152), Y150 (= Y155), K154 (= K159)
- binding calcium ion: E232 (= E239), T233 (≠ V240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ A16), R14 (= R17), T36 (≠ V39), N58 (≠ D64), V59 (≠ I65), N85 (= N91), A86 (= A92), G87 (= G93), I88 (≠ F94), S137 (= S143), Y150 (= Y155), K154 (= K159), P180 (= P185), G181 (= G186), I183 (= I188)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
43% identity, 98% coverage: 4:248/249 of query aligns to 3:247/248 of 4cqmA
- active site: G17 (= G18), S143 (= S143), Y156 (= Y155), K160 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), S16 (≠ R17), G17 (= G18), I18 (≠ L19), D37 (= D38), L38 (≠ V39), A61 (= A63), V63 (≠ I65), C90 (≠ N91), A91 (= A92), G92 (= G93), I93 (≠ F94), V113 (= V114), I141 (= I141), S143 (= S143), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), I189 (= I188), T191 (= T190), P192 (≠ E191), M193 (= M192), T194 (≠ V193)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
42% identity, 98% coverage: 4:248/249 of query aligns to 1:241/243 of 1q7cA
- active site: G15 (= G18), S137 (= S143), Q147 (= Q152), F150 (≠ Y155), K154 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G14), S13 (≠ A16), R14 (= R17), A35 (≠ D38), T36 (≠ V39), L57 (≠ A63), N58 (≠ D64), V59 (≠ I65), G87 (= G93), I88 (≠ F94)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
41% identity, 99% coverage: 3:248/249 of query aligns to 4:241/243 of 4i08A
- active site: G19 (= G18), N113 (≠ M115), S141 (= S143), Q151 (= Q152), Y154 (= Y155), K158 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (= R17), I20 (≠ L19), T40 (≠ L40), N62 (≠ D64), V63 (≠ I65), N89 (= N91), A90 (= A92), G140 (≠ S142), S141 (= S143), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), T189 (= T190)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
42% identity, 97% coverage: 6:247/249 of query aligns to 15:261/262 of Q9L9F8
- S152 (= S143) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y155) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K159) mutation to I: Does not alter the catalytic turnover.
Query Sequence
>RR42_RS25125 FitnessBrowser__Cup4G11:RR42_RS25125
MDLQIKDRVAIVTGSARGLGAATARRLAEEGARVVVTDVLRERAEETVAALRADGLQAHC
VIADITKAEDVSRLVEETVAQFGGVHILVNNAGFPRDKYLVKMSEEDWDLVIAVMLKGAF
LATRAVMPHFIEQGWGRVINISSRAHLGNPTQANYSAAKAGLIGVAKALAIEEGRYGVTV
NCVAPGFIETEMVQALPSYETIKERAVQMQPIKRVGRPGDIADAVAFLASERAGFITGEV
LHVSGGRFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory