SitesBLAST
Comparing RR42_RS25455 FitnessBrowser__Cup4G11:RR42_RS25455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W) (see paper)
53% identity, 99% coverage: 3:393/394 of query aligns to 2:391/392 of P45359
- V77 (≠ I79) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C90) modified: Disulfide link with 378, In inhibited form
- S96 (≠ V98) binding
- N153 (≠ H154) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AH 281:282) binding
- A286 (≠ K288) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C380) modified: Disulfide link with 88, In inhibited form
- A386 (= A388) binding
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
52% identity, 99% coverage: 3:393/394 of query aligns to 2:391/392 of 4xl4A
- active site: C88 (= C90), H348 (= H350), S378 (≠ C380), G380 (= G382)
- binding coenzyme a: L148 (= L149), H156 (= H157), R220 (= R221), L231 (= L232), A243 (= A245), S247 (= S249), F319 (= F321), H348 (= H350)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
51% identity, 100% coverage: 2:394/394 of query aligns to 2:392/392 of 1ou6A
- active site: C89 (= C90), H348 (= H350), C378 (= C380), G380 (= G382)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (= L149), H156 (= H157), M157 (= M158), F235 (= F236), A243 (= A245), S247 (= S249), A318 (= A320), F319 (= F321), H348 (= H350)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
51% identity, 100% coverage: 2:394/394 of query aligns to 1:391/391 of 2vu1A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
51% identity, 99% coverage: 5:394/394 of query aligns to 2:389/389 of 2vu2A
- active site: C86 (= C90), H345 (= H350), C375 (= C380), G377 (= G382)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (= H157), M154 (= M158), F232 (= F236), S244 (= S249), G245 (= G250), F316 (= F321), H345 (= H350)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
51% identity, 99% coverage: 5:394/394 of query aligns to 2:389/389 of 1dm3A
- active site: C86 (= C90), H345 (= H350), C375 (= C380), G377 (= G382)
- binding acetyl coenzyme *a: C86 (= C90), L145 (= L149), H153 (= H157), M154 (= M158), R217 (= R221), S224 (≠ D228), M225 (= M229), A240 (= A245), S244 (= S249), M285 (= M290), A315 (= A320), F316 (= F321), H345 (= H350), C375 (= C380)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
51% identity, 99% coverage: 5:394/394 of query aligns to 2:389/389 of 1dlvA
- active site: C86 (= C90), H345 (= H350), C375 (= C380), G377 (= G382)
- binding coenzyme a: C86 (= C90), L145 (= L149), H153 (= H157), M154 (= M158), R217 (= R221), L228 (= L232), A240 (= A245), S244 (= S249), H345 (= H350)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
51% identity, 100% coverage: 1:394/394 of query aligns to 1:392/392 of P07097
- Q64 (≠ M65) mutation to A: Slightly lower activity.
- C89 (= C90) mutation to A: Loss of activity.
- C378 (= C380) mutation to G: Loss of activity.
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
51% identity, 99% coverage: 5:394/394 of query aligns to 2:389/389 of 2wkuA
- active site: C86 (= C90), H345 (= H350), C375 (= C380), G377 (= G382)
- binding D-mannose: S6 (= S9), A7 (≠ G10), R38 (= R41), K182 (≠ R186), D194 (= D198), V280 (= V285), D281 (= D286), T287 (≠ I292), P331 (= P336), S332 (≠ A337), V334 (= V339), V336 (≠ P341), F360 (≠ Y365)
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
51% identity, 99% coverage: 5:394/394 of query aligns to 3:390/390 of 1m1oA
- active site: A87 (≠ C90), H346 (= H350), C376 (= C380), G378 (= G382)
- binding acetoacetyl-coenzyme a: L86 (= L89), A87 (≠ C90), L146 (= L149), H154 (= H157), M155 (= M158), R218 (= R221), S225 (≠ D228), M226 (= M229), A241 (= A245), G242 (= G246), S245 (= S249), A316 (= A320), F317 (= F321), H346 (= H350), I377 (= I381), G378 (= G382)
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
51% identity, 99% coverage: 4:393/394 of query aligns to 3:392/393 of P14611
- C88 (= C90) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (= H157) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ H219) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R221) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S249) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H350) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C380) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
51% identity, 99% coverage: 4:393/394 of query aligns to 3:392/393 of 4o9cC
- active site: S88 (≠ C90), H349 (= H350), C379 (= C380), G381 (= G382)
- binding coenzyme a: S88 (≠ C90), L148 (= L149), R221 (= R221), F236 (= F236), A244 (= A245), S248 (= S249), L250 (= L251), A319 (= A320), F320 (= F321), H349 (= H350)
1wl4A Human cytosolic acetoacetyl-coa thiolase complexed with coa (see paper)
47% identity, 99% coverage: 5:393/394 of query aligns to 5:393/394 of 1wl4A
- active site: C89 (= C90), H350 (= H350), C380 (= C380), G382 (= G382)
- binding coenzyme a: L148 (= L149), M157 (= M158), R220 (= R221), Y234 (≠ V235), P245 (≠ A245), A246 (≠ G246), S249 (= S249), A320 (= A320), F321 (= F321), H350 (= H350)
Q9BWD1 Acetyl-CoA acetyltransferase, cytosolic; Acetyl-CoA transferase-like protein; Cytosolic acetoacetyl-CoA thiolase; EC 2.3.1.9 from Homo sapiens (Human) (see 2 papers)
47% identity, 99% coverage: 5:393/394 of query aligns to 8:396/397 of Q9BWD1
- K211 (= K209) to R: in dbSNP:rs25683
- R223 (= R221) binding
- S226 (≠ A224) binding
- S252 (= S249) binding
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
45% identity, 99% coverage: 1:392/394 of query aligns to 3:394/397 of P42765
- C92 (= C90) mutation to A: Decreased acyl-CoA hydrolase activity.; mutation to S: Decreased acyl-CoA hydrolase activity; when associated with A-382.
- R224 (= R221) binding
- T227 (≠ A224) binding
- S251 (= S249) binding
- C382 (= C380) mutation to S: Decreased acyl-CoA hydrolase activity; when associated with S-92.
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
50% identity, 99% coverage: 3:393/394 of query aligns to 4:394/394 of 5f38D
- active site: C90 (= C90), A348 (≠ S347), A378 (≠ V377), L380 (≠ M379)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C90), L151 (= L149), A246 (= A245), S250 (= S249), I252 (≠ L251), A321 (= A320), F322 (= F321), H351 (= H350)
8jg2A Crystal structure of a biosynthetic thiolase from megasphaera hexanoica soaked with hexanoyl-coa
47% identity, 98% coverage: 3:388/394 of query aligns to 3:386/393 of 8jg2A
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
49% identity, 99% coverage: 3:394/394 of query aligns to 2:391/391 of 5f38B
- active site: C88 (= C90), H347 (= H350), C377 (= C380), G379 (= G382)
- binding coenzyme a: C88 (= C90), L149 (= L149), K219 (≠ R221), F234 (= F236), A242 (= A245), S246 (= S249), A317 (= A320), F318 (= F321), H347 (= H350)
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
45% identity, 99% coverage: 1:392/394 of query aligns to 6:393/395 of 4c2jD
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
44% identity, 99% coverage: 3:394/394 of query aligns to 1:398/400 of 5bz4K
- active site: C87 (= C90), H354 (= H350), C384 (= C380), G386 (= G382)
- binding coenzyme a: C87 (= C90), R146 (≠ L149), M160 (≠ V160), R220 (= R221), A246 (= A245), G247 (= G246), S250 (= S249), Q252 (≠ L251), M291 (= M290), A321 (= A320), F322 (= F321), H354 (= H350)
Query Sequence
>RR42_RS25455 FitnessBrowser__Cup4G11:RR42_RS25455
MTREVVVVSGVRTAIGTFGGSLKDLSPTQMGAMVVREALARAQVSGDDVGHVVFGNVIQT
EPRDMYLGRVAAVEGGVTIDAPALTVNRLCGSGLQAIVSAAQTILLGDADVAIGGGAESM
SRAPYLAQSARWGARMGDAKMLDMMLGALHDPFHGIHMGVTAENVAKEYDISRVQQDEAA
LESHRRASAAIRAGHFKDQILPVTLKGRKGDVTFDTDEHVRHDAVMEDMTKLKPVFVKEN
GTVTAGNASGLNDAAAAVVLMERAEAEKRGLKPMARLVSYAHAGVDPKTMGIGPVPATKK
ALERAGLTVADLDVIEANEAFAAQACAVTKALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRVQGRYALVTMCIGGGQGIAAIFERV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory