Comparing RR42_RS25790 FitnessBrowser__Cup4G11:RR42_RS25790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
28% identity, 92% coverage: 55:744/748 of query aligns to 11:718/732 of 8gy3C
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
24% identity, 51% coverage: 213:596/748 of query aligns to 7:409/748 of 5y6qC
Sites not aligning to the query:
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
26% identity, 52% coverage: 209:594/748 of query aligns to 3:391/420 of 3hrdE
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
26% identity, 52% coverage: 209:594/748 of query aligns to 3:391/420 of 3hrdA
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
26% identity, 52% coverage: 209:594/748 of query aligns to 4:392/425 of Q0QLF2
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
32% identity, 17% coverage: 617:744/748 of query aligns to 612:745/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
32% identity, 17% coverage: 617:744/748 of query aligns to 620:753/769 of O33819
Sites not aligning to the query:
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
30% identity, 19% coverage: 600:744/748 of query aligns to 171:316/330 of 3hrdB
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
30% identity, 19% coverage: 600:744/748 of query aligns to 171:316/330 of Q0QLF1
Sites not aligning to the query:
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
25% identity, 59% coverage: 199:639/748 of query aligns to 10:455/731 of 5g5gC
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 59% coverage: 199:639/748 of query aligns to 10:455/732 of P77489
Sites not aligning to the query:
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
24% identity, 48% coverage: 213:573/748 of query aligns to 15:414/803 of 1n60B
Sites not aligning to the query:
P19919 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
24% identity, 48% coverage: 213:573/748 of query aligns to 21:420/809 of P19919
Sites not aligning to the query:
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
24% identity, 48% coverage: 213:573/748 of query aligns to 16:415/804 of 1zxiB
Sites not aligning to the query:
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
24% identity, 48% coverage: 213:573/748 of query aligns to 16:415/804 of 1n62B
Sites not aligning to the query:
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
24% identity, 48% coverage: 213:573/748 of query aligns to 16:415/804 of 1n5wB
Sites not aligning to the query:
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
24% identity, 48% coverage: 213:573/748 of query aligns to 17:416/805 of 1n63B
Sites not aligning to the query:
P19913 Carbon monoxide dehydrogenase large chain; CO dehydrogenase subunit L; CO-DH L; EC 1.2.5.3 from Hydrogenophaga pseudoflava (Pseudomonas carboxydoflava) (see paper)
23% identity, 47% coverage: 226:573/748 of query aligns to 31:417/803 of P19913
1ffvB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
23% identity, 47% coverage: 226:573/748 of query aligns to 25:411/797 of 1ffvB
Sites not aligning to the query:
1ffuB Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
23% identity, 47% coverage: 226:573/748 of query aligns to 25:411/797 of 1ffuB
Sites not aligning to the query:
>RR42_RS25790 FitnessBrowser__Cup4G11:RR42_RS25790
MTPLQRNDSNESSDVKSPQRRRLLKSAVALLAIPAAGSLAIPVVYSLSEKHSGTPAAEVE
VSDWIWIEPSGHTIIGVSQCEFGQGIYTGLPQVLADEMDADWENISVKFVTARDAYRNDA
GDEPLQQYTGASMSMTYFFERMRLAGAQARDVLLRAGAQRLGVRSSQCTTRTGRVIHPAT
GRSIGYGEVVADAIKLRINPHPRMKVPSEHSLIGKNLRRVDTPPKVDGSAVFGMDVEVPG
MLIGAVRMAPSVTGSIVRIRNEAEIRKREGVKAIVVTSLWPVPTRNTVIVVANSYWTAKQ
ALDALDIEFDAGAARNTSSDLIRKQFVEGLDSKDAPVARRIGNPEEILNGPGKRVVVSAD
YHTPYVAHATMEPVVATVDVREGEIEAWGPFQGQDFLRGELGKAFGLPPDKVTVHTVYLG
GSFGRKYLPDFALHAAAASKAVGKPVKVIRSREDDTRHSYYRPGAAGRFRAVLGDGGMPL
ALHARISGQSLYGVIKQDKMAAVGGWDETMVESIYDLIYRVPHLLVDAVDVKQPIPLSFL
RSVGSTSSVFFLESFVSELAHAAGADDYQYRRKLLAEQPLALRVLDATAKAAQWEREAGP
GVFRGMAFNVYTGRGEGFQTYVALVIELEVVQGRVKLKRAVCGVDAGRAVNPGLIKANME
GGIGFALTNTFKSELTFDKGAIRQSSFHDYPLLQLAEMPNVEVTILESDRPPQGCGEVVL
GPTAPAVASAMFHATGTRFRSMPLPQSV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory