SitesBLAST
Comparing RR42_RS26105 FitnessBrowser__Cup4G11:RR42_RS26105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 87% coverage: 21:423/462 of query aligns to 11:420/425 of O59010
- S65 (≠ T73) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S284) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 284:286) binding
- M311 (≠ L319) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T322) binding
- V355 (= V363) binding
- D394 (≠ S397) binding
- M395 (≠ E398) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R400) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N404) binding
- D405 (≠ N408) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 87% coverage: 21:422/462 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L54), F46 (≠ L54), P75 (≠ D83), L91 (≠ V100), F95 (≠ I104), L130 (≠ T146), I133 (≠ F149), I159 (≠ V175), Y167 (vs. gap), K196 (≠ A204), G200 (≠ Y208), I207 (= I215), F210 (= F218), L250 (≠ I258), I262 (= I270), M269 (≠ L277), T334 (≠ S342), V335 (≠ L343), G336 (≠ T344), T340 (= T348), L343 (≠ A351), M399 (≠ L402)
- binding aspartic acid: S277 (= S285), S278 (= S286), T314 (= T322), G354 (= G362), A358 (≠ S366), G359 (= G367), D394 (≠ S397), R397 (= R400), T398 (≠ A401)
- binding sodium ion: Y89 (≠ F98), T92 (≠ V101), S93 (= S102), G306 (= G314), T308 (≠ S316), N310 (= N318), N310 (= N318), M311 (≠ L319), D312 (= D320), S349 (= S357), I350 (≠ K358), T352 (≠ A360), N401 (= N404), V402 (≠ L405), D405 (≠ N408)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 86% coverage: 21:417/462 of query aligns to 2:405/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 86% coverage: 21:417/462 of query aligns to 8:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G77), V83 (≠ L95), I157 (≠ M176), Y164 (vs. gap), K193 (≠ A204), T305 (≠ S316), I306 (≠ F317), I347 (≠ K358)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L26), M199 (= M210), S275 (= S286), T311 (= T322), G356 (= G367), L384 (= L390), D391 (≠ S397), R394 (= R400)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 87% coverage: 21:420/462 of query aligns to 3:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 86% coverage: 21:417/462 of query aligns to 3:406/408 of 6bauA
- binding cysteine: S270 (= S286), M303 (≠ L319), T306 (= T322), A345 (= A361), G346 (= G362), V347 (= V363), G351 (= G367), D386 (≠ S397), C389 (≠ R400), T390 (≠ A401), N393 (= N404)
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 88% coverage: 21:426/462 of query aligns to 9:423/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 88% coverage: 21:426/462 of query aligns to 6:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ A204), G195 (≠ Y208), R282 (≠ M294)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S284), S272 (= S285), S273 (= S286), M307 (≠ L319), T310 (= T322), G353 (= G365), A354 (≠ S366), R394 (= R400), T395 (≠ A401)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 88% coverage: 21:426/462 of query aligns to 7:421/425 of 6zgbA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 88% coverage: 21:426/462 of query aligns to 9:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S284), S275 (= S285), S276 (= S286), T313 (= T322), G353 (= G362), V354 (= V363), A357 (≠ S366), G358 (= G367), D394 (≠ S397), R397 (= R400), T398 (≠ A401)
- binding decyl-beta-d-maltopyranoside: L194 (≠ A204), G198 (≠ Y208), Y202 (≠ V212)
- binding sodium ion: Y87 (≠ F98), T90 (≠ V101), S91 (= S102), S276 (= S286), G305 (= G314), A306 (≠ Y315), T307 (≠ S316), N309 (= N318), N309 (= N318), M310 (≠ L319), D311 (= D320), S348 (= S357), I349 (≠ K358), G350 (= G359), T351 (≠ A360), N401 (= N404), V402 (≠ L405), D405 (≠ N408)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 88% coverage: 21:426/462 of query aligns to 2:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S284), S265 (= S286), M299 (≠ L319), T302 (= T322), T340 (≠ A360), G342 (= G362), V343 (= V363), G347 (= G367), D383 (≠ S397), R386 (= R400), T387 (≠ A401), N390 (= N404)
- binding decyl-beta-d-maltopyranoside: H23 (= H42), V212 (≠ L233), A216 (≠ G237)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 86% coverage: 21:417/462 of query aligns to 3:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 87% coverage: 37:438/462 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V87), G89 (= G88), G92 (= G91), A95 (= A94), V96 (≠ L95), Y99 (≠ F98), M163 (≠ V175), F167 (= F179), F293 (≠ L309), V297 (≠ T313)
- binding aspartic acid: S268 (= S285), S269 (= S286), T306 (= T322), G346 (= G362), I347 (≠ V363), A350 (≠ S366), G351 (= G367), D380 (≠ S397), R383 (= R400), T384 (≠ A401)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
27% identity, 95% coverage: 2:438/462 of query aligns to 18:505/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 81% coverage: 37:410/462 of query aligns to 25:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I78), S80 (≠ V87), G81 (= G88), G84 (= G91), Y91 (≠ F98), M156 (≠ V175), F160 (= F179), F286 (≠ L309), V290 (≠ T313)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I70), I148 (= I167), S262 (= S286), S263 (≠ E287), A292 (≠ Y315), T293 (≠ S316), M296 (≠ L319), T299 (= T322), G329 (= G359), A336 (≠ S366), G337 (= G367), D366 (≠ S397), R369 (= R400), N373 (= N404)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
26% identity, 89% coverage: 31:443/462 of query aligns to 26:486/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 82% coverage: 30:408/462 of query aligns to 11:403/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S285), S281 (= S286), T318 (= T322), G363 (= G367), M367 (≠ L371), V385 (≠ L390), D388 (= D393), R395 (= R400), T396 (≠ A401)
- binding dodecyl beta-D-glucopyranoside: V16 (= V35), V19 (= V38), I20 (= I39), W389 (≠ R394)
- binding cholesterol hemisuccinate: R80 (≠ K89), R84 (≠ L93), I95 (= I104), I252 (≠ V254)
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 82% coverage: 30:408/462 of query aligns to 10:404/425 of 7xr4A
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
28% identity, 77% coverage: 55:410/462 of query aligns to 79:469/532 of P43007
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ H200) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ E398) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
24% identity, 98% coverage: 3:457/462 of query aligns to 7:533/572 of P43006
- C38 (vs. gap) modified: S-palmitoyl cysteine; mutation to S: Severely impairs glutamate uptake activity.
Query Sequence
>RR42_RS26105 FitnessBrowser__Cup4G11:RR42_RS26105
MPATRKPTKETPMEKDNHPKPFYRSLYFQVITAIVIGVILGHFYPQAGAAMKPLGDGFIK
LIKMIIAPIIFCTVVVGIAGMEDMKKVGKTGGLALLYFEVVSAIALVVGLVIINIAKPGV
GMNVDVSTLDTKSIAAYTGPGKMQGTVDFLLHVIPNTVVDAFAQGEILQVLLFAVMFGFA
LHKFGGRGTLVFDFIEKFSHVLFAIVGYIMKVAPIGAFGAMAFTIGKYGVGSLLQLGQLM
ATFYATCLFFIFVVLGGIARAHGFSIWKFIKYIKEELLIVLGTSSSESVLPRMMAKLENL
GARKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTEMSLTQQLTLLAVLLLTSKGA
AGVTGSGFIVLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLIGNGVATVVVAKWTG
DLDVARMHRRLDNESDAEADEPEAVLDPMVARMPASGTSMTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory