SitesBLAST
Comparing RR42_RS26245 FitnessBrowser__Cup4G11:RR42_RS26245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
34% identity, 83% coverage: 12:491/575 of query aligns to 3:467/539 of 6lpiB
- active site: I27 (≠ V36), G29 (= G38), G30 (≠ E39), S31 (= S40), I32 (≠ Y41), E53 (= E63), C76 (≠ T86), F115 (= F125), Q116 (= Q126), E117 (= E127), K165 (≠ E175), M256 (≠ W266), A283 (≠ S294), V375 (≠ A398), G401 (= G423), M403 (= M425), D428 (= D450), N455 (= N477), A457 (≠ I479), L458 (≠ W480), L460 (≠ T482), V461 (≠ I483), Q464 (≠ E488)
- binding flavin-adenine dinucleotide: R155 (= R165), G212 (= G220), G213 (= G221), G214 (= G223), T236 (≠ A246), L237 (≠ W247), M238 (≠ R248), L254 (≠ V264), M256 (≠ W266), H257 (≠ A267), G276 (= G286), A277 (≠ T287), R278 (= R288), D280 (≠ G290), R282 (≠ T293), A283 (≠ S294), D300 (≠ Y313), I301 (≠ P314), D319 (= D332), V320 (= V333), M380 (≠ L403), G398 (vs. gap)
- binding magnesium ion: D428 (= D450), N455 (= N477)
- binding thiamine diphosphate: E53 (= E63), C76 (≠ T86), P79 (= P89), G376 (= G399), Q377 (≠ N400), H378 (≠ Y401), G401 (= G423), M403 (= M425), G427 (= G449), D428 (= D450), G429 (= G451), S430 (≠ C452), M433 (= M455), N455 (= N477), A457 (≠ I479), L458 (≠ W480), G459 (= G481), L460 (≠ T482), V461 (≠ I483)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 12:558/599 of 1n0hA
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), R230 (= R230), M266 (≠ W266), V293 (≠ T293), V409 (≠ A398), L434 (≠ V422), G435 (= G423), M437 (= M425), D462 (= D450), N489 (= N477), E491 (≠ I479), Q492 (≠ W480), M494 (≠ T482), V495 (≠ I483), W498 (≠ H486), L520 (= L508), G525 (≠ R513), L526 (≠ G514)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A398), G410 (= G399), Q411 (≠ N400), H412 (≠ Y401), G435 (= G423), M437 (= M425), G461 (= G449), D462 (= D450), A463 (≠ G451), S464 (≠ C452), M467 (= M455), N489 (= N477), E491 (≠ I479), Q492 (≠ W480), G493 (= G481), V495 (≠ I483)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (≠ E39), A35 (≠ S40), V109 (= V115), P110 (≠ G116), F119 (= F125), K169 (≠ E175), M266 (≠ W266), D291 (≠ E291), R292 (≠ A292), V495 (≠ I483), W498 (≠ H486)
- binding flavin-adenine dinucleotide: R159 (= R165), G219 (= G220), A220 (≠ G221), G221 (≠ S222), N224 (≠ T225), T246 (≠ A246), L247 (≠ W247), Q248 (≠ R248), L264 (≠ V264), G265 (= G265), M266 (≠ W266), H267 (≠ A267), G286 (= G286), A287 (≠ T287), R288 (= R288), D290 (≠ G290), R292 (≠ A292), V293 (≠ T293), E319 (≠ Y313), V320 (≠ P314), N324 (≠ E318), G337 (≠ A331), D338 (= D332), A339 (vs. gap), M414 (≠ L403), G432 (vs. gap), G433 (≠ T421)
- binding magnesium ion: D462 (= D450), N489 (= N477), E491 (≠ I479)
- binding thiamine diphosphate: Y31 (≠ V36), E57 (= E63), P83 (= P89)
Sites not aligning to the query:
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 10:550/591 of 5wkcA
- active site: Y29 (≠ V36), G31 (= G38), G32 (≠ E39), A33 (≠ S40), I34 (≠ Y41), E55 (= E63), T78 (= T86), F117 (= F125), Q118 (= Q126), E119 (= E127), K167 (≠ E175), R222 (= R230), M258 (≠ W266), V285 (≠ T293), V401 (≠ A398), L426 (≠ V422), G427 (= G423), M429 (= M425), D454 (= D450), N481 (= N477), E483 (≠ I479), Q484 (≠ W480), M486 (≠ T482), V487 (≠ I483), W490 (≠ H486), L512 (= L508), G517 (≠ R513), L518 (≠ G514)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (≠ A398), G402 (= G399), Q403 (≠ N400), H404 (≠ Y401), G427 (= G423), M429 (= M425), G453 (= G449), D454 (= D450), A455 (≠ G451), S456 (≠ C452), M459 (= M455), N481 (= N477), E483 (≠ I479), Q484 (≠ W480), G485 (= G481), M486 (≠ T482), V487 (≠ I483)
- binding ethaneperoxoic acid: G32 (≠ E39), Q118 (= Q126)
- binding flavin-adenine dinucleotide: R157 (= R165), G211 (= G220), A212 (≠ G221), G213 (≠ S222), N216 (≠ T225), T238 (≠ A246), L239 (≠ W247), Q240 (≠ R248), L256 (≠ V264), M258 (≠ W266), G278 (= G286), A279 (≠ T287), R280 (= R288), R284 (≠ A292), V285 (≠ T293), E311 (≠ Y313), V312 (≠ P314), N316 (≠ E318), D330 (= D332), A331 (vs. gap), M406 (≠ L403), G424 (vs. gap)
- binding magnesium ion: D454 (= D450), N481 (= N477), E483 (≠ I479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (≠ E39), A33 (≠ S40), V107 (= V115), F117 (= F125), K167 (≠ E175), M258 (≠ W266), R284 (≠ A292), M486 (≠ T482), W490 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P37), E55 (= E63)
Sites not aligning to the query:
6wo1A Hybrid acetohydroxyacid synthase complex structure with cryptococcus neoformans ahas catalytic subunit and saccharomyces cerevisiae ahas regulatory subunit (see paper)
31% identity, 80% coverage: 16:477/575 of query aligns to 10:478/551 of 6wo1A
- active site: Y30 (≠ V36), G32 (= G38), G33 (≠ E39), A34 (≠ S40), I35 (≠ Y41), E56 (= E63), T79 (= T86), F118 (= F125), Q119 (= Q126), E120 (= E127), K168 (≠ E175), M255 (≠ W266), V282 (≠ T293), V398 (≠ A398), G424 (= G423), M426 (= M425), D451 (= D450), N478 (= N477)
- binding 2-methylpyrimidin-4-amine: G424 (= G423), T425 (≠ S424), M426 (= M425)
- binding diphosphate: V398 (≠ A398), G399 (= G399), Q400 (≠ N400), H401 (≠ Y401), G450 (= G449), D451 (= D450), A452 (≠ G451), S453 (≠ C452)
- binding flavin-adenine dinucleotide: D97 (= D104), R158 (= R165), G208 (= G220), G210 (= G221), S213 (≠ W224), T235 (≠ A246), L236 (≠ W247), Q237 (≠ R248), I253 (≠ V264), G254 (= G265), M255 (≠ W266), G275 (= G286), V276 (≠ T287), R277 (= R288), D279 (≠ G290), R281 (≠ A292), V282 (≠ T293), E308 (≠ Y313), I309 (≠ P314), D327 (= D332), V328 (= V333), Q402 (≠ A402), G421 (vs. gap), G422 (≠ T421)
- binding magnesium ion: D451 (= D450), N478 (= N477)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 10:555/596 of 1t9cA
- active site: Y29 (≠ V36), G31 (= G38), G32 (≠ E39), A33 (≠ S40), I34 (≠ Y41), E55 (= E63), T78 (= T86), F117 (= F125), Q118 (= Q126), E119 (= E127), K167 (≠ E175), R227 (= R230), M263 (≠ W266), V290 (≠ T293), V406 (≠ A398), L431 (≠ V422), G432 (= G423), M434 (= M425), D459 (= D450), N486 (= N477), E488 (≠ I479), Q489 (≠ W480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (= L508), G522 (≠ R513), L523 (≠ G514)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E39), V107 (= V115), P108 (≠ G116), F117 (= F125), K167 (≠ E175), D288 (≠ E291), R289 (≠ A292), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R165), G216 (= G220), A217 (≠ G221), G218 (≠ S222), N221 (≠ T225), T243 (≠ A246), L244 (≠ W247), Q245 (≠ R248), L261 (≠ V264), M263 (≠ W266), H264 (≠ A267), G283 (= G286), A284 (≠ T287), R285 (= R288), D287 (≠ G290), R289 (≠ A292), V290 (≠ T293), E316 (≠ Y313), V317 (≠ P314), N321 (≠ E318), G334 (≠ A331), D335 (= D332), A336 (vs. gap), M411 (≠ L403), G429 (vs. gap), G430 (≠ T421)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ I479)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 10:555/596 of 1t9dA
- active site: Y29 (≠ V36), G31 (= G38), G32 (≠ E39), A33 (≠ S40), I34 (≠ Y41), E55 (= E63), T78 (= T86), F117 (= F125), Q118 (= Q126), E119 (= E127), K167 (≠ E175), R227 (= R230), M263 (≠ W266), V290 (≠ T293), V406 (≠ A398), L431 (≠ V422), G432 (= G423), M434 (= M425), D459 (= D450), N486 (= N477), E488 (≠ I479), Q489 (≠ W480), M491 (≠ T482), V492 (≠ I483), W495 (≠ H486), L517 (= L508), G522 (≠ R513), L523 (≠ G514)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (≠ E39), A33 (≠ S40), V107 (= V115), P108 (≠ G116), F117 (= F125), K167 (≠ E175), M263 (≠ W266), D288 (≠ E291), R289 (≠ A292), W495 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R165), G216 (= G220), A217 (≠ G221), G218 (≠ S222), N221 (≠ T225), T243 (≠ A246), L244 (≠ W247), Q245 (≠ R248), M260 (≠ H263), L261 (≠ V264), H264 (≠ A267), G283 (= G286), A284 (≠ T287), R285 (= R288), D287 (≠ G290), R289 (≠ A292), V290 (≠ T293), E316 (≠ Y313), V317 (≠ P314), N321 (≠ E318), G334 (≠ A331), D335 (= D332), A336 (vs. gap), Q410 (≠ A402), M411 (≠ L403), G429 (vs. gap), G430 (≠ T421)
- binding magnesium ion: D459 (= D450), N486 (= N477), E488 (≠ I479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E63), P81 (= P89), Q118 (= Q126), G432 (= G423), M434 (= M425), M464 (= M455)
Sites not aligning to the query:
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 11:556/597 of 1t9aA
- active site: Y30 (≠ V36), G32 (= G38), G33 (≠ E39), A34 (≠ S40), I35 (≠ Y41), E56 (= E63), T79 (= T86), F118 (= F125), Q119 (= Q126), E120 (= E127), K168 (≠ E175), R228 (= R230), M264 (≠ W266), V291 (≠ T293), V407 (≠ A398), L432 (≠ V422), G433 (= G423), M435 (= M425), D460 (= D450), N487 (= N477), E489 (≠ I479), Q490 (≠ W480), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486), L518 (= L508), G523 (≠ R513), L524 (≠ G514)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (≠ E39), V108 (= V115), P109 (≠ G116), F118 (= F125), K168 (≠ E175), M264 (≠ W266), D289 (≠ E291), R290 (≠ A292), M492 (≠ T482), V493 (≠ I483), W496 (≠ H486)
- binding flavin-adenine dinucleotide: R158 (= R165), G217 (= G220), A218 (≠ G221), G219 (≠ S222), N222 (≠ T225), T244 (≠ A246), L245 (≠ W247), Q246 (≠ R248), L262 (≠ V264), M264 (≠ W266), H265 (≠ A267), G284 (= G286), A285 (≠ T287), R286 (= R288), D288 (≠ G290), R290 (≠ A292), V291 (≠ T293), E317 (≠ Y313), V318 (≠ P314), N322 (≠ E318), G335 (≠ A331), D336 (= D332), A337 (vs. gap), Q411 (≠ A402), M412 (≠ L403), G430 (vs. gap), G431 (≠ T421)
- binding magnesium ion: D460 (= D450), N487 (= N477), E489 (≠ I479)
- binding propyl trihydrogen diphosphate: V407 (≠ A398), G408 (= G399), Q409 (≠ N400), H410 (≠ Y401), M435 (= M425), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ C452), N487 (= N477), E489 (≠ I479), Q490 (≠ W480), G491 (= G481), M492 (≠ T482)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G423), M435 (= M425), M465 (= M455)
Sites not aligning to the query:
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 10:554/595 of 1t9bB
- active site: Y29 (≠ V36), G31 (= G38), G32 (≠ E39), A33 (≠ S40), I34 (≠ Y41), E55 (= E63), T78 (= T86), F117 (= F125), Q118 (= Q126), E119 (= E127), K167 (≠ E175), R226 (= R230), M262 (≠ W266), V289 (≠ T293), V405 (≠ A398), L430 (≠ V422), G431 (= G423), M433 (= M425), D458 (= D450), N485 (= N477), E487 (≠ I479), Q488 (≠ W480), M490 (≠ T482), V491 (≠ I483), W494 (≠ H486), L516 (= L508), G521 (≠ R513), L522 (≠ G514)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V115), P108 (≠ G116), D287 (≠ E291), R288 (≠ A292), M490 (≠ T482), W494 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R165), G215 (= G220), A216 (≠ G221), G217 (≠ S222), N220 (≠ T225), T242 (≠ A246), L243 (≠ W247), Q244 (≠ R248), M259 (≠ H263), L260 (≠ V264), M262 (≠ W266), H263 (≠ A267), G282 (= G286), A283 (≠ T287), R284 (= R288), D286 (≠ G290), R288 (≠ A292), V289 (≠ T293), E315 (≠ Y313), V316 (≠ P314), N320 (≠ E318), G333 (≠ A331), D334 (= D332), A335 (vs. gap), Q409 (≠ A402), M410 (≠ L403), G428 (vs. gap), G429 (≠ T421)
- binding magnesium ion: D458 (= D450), N485 (= N477), E487 (≠ I479)
Sites not aligning to the query:
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 10:542/583 of 1t9bA
- active site: Y29 (≠ V36), G31 (= G38), G32 (≠ E39), A33 (≠ S40), I34 (≠ Y41), E55 (= E63), T78 (= T86), F117 (= F125), Q118 (= Q126), E119 (= E127), K167 (≠ E175), R214 (= R230), M250 (≠ W266), V277 (≠ T293), V393 (≠ A398), L418 (≠ V422), G419 (= G423), M421 (= M425), D446 (= D450), N473 (= N477), E475 (≠ I479), Q476 (≠ W480), M478 (≠ T482), V479 (≠ I483), W482 (≠ H486), L504 (= L508), G509 (≠ R513), L510 (≠ G514)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V115), P108 (≠ G116), F117 (= F125), D275 (≠ E291), R276 (≠ A292), M478 (≠ T482), W482 (≠ H486)
- binding flavin-adenine dinucleotide: R157 (= R165), G203 (= G220), A204 (≠ G221), G205 (≠ S222), N208 (≠ T225), T230 (≠ A246), L231 (≠ W247), Q232 (≠ R248), M247 (≠ H263), L248 (≠ V264), M250 (≠ W266), H251 (≠ A267), G270 (= G286), A271 (≠ T287), R272 (= R288), D274 (≠ G290), R276 (≠ A292), V277 (≠ T293), E303 (≠ Y313), V304 (≠ P314), N308 (≠ E318), D322 (= D332), A323 (vs. gap), Q397 (≠ A402), M398 (≠ L403), G416 (vs. gap), G417 (≠ T421)
- binding magnesium ion: D446 (= D450), N473 (= N477), E475 (≠ I479)
Sites not aligning to the query:
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 9:541/582 of 1t9dB
- active site: Y28 (≠ V36), G30 (= G38), G31 (≠ E39), A32 (≠ S40), I33 (≠ Y41), E54 (= E63), T77 (= T86), F116 (= F125), Q117 (= Q126), E118 (= E127), K166 (≠ E175), R213 (= R230), M249 (≠ W266), V276 (≠ T293), V392 (≠ A398), L417 (≠ V422), G418 (= G423), M420 (= M425), D445 (= D450), N472 (= N477), E474 (≠ I479), Q475 (≠ W480), M477 (≠ T482), V478 (≠ I483), W481 (≠ H486), L503 (= L508), G508 (≠ R513), L509 (≠ G514)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (≠ E39), A32 (≠ S40), V106 (= V115), P107 (≠ G116), F116 (= F125), K166 (≠ E175), M249 (≠ W266), D274 (≠ E291), R275 (≠ A292), W481 (≠ H486)
- binding flavin-adenine dinucleotide: R156 (= R165), G202 (= G220), A203 (≠ G221), G204 (≠ S222), N207 (≠ T225), T229 (≠ A246), L230 (≠ W247), Q231 (≠ R248), L247 (≠ V264), M249 (≠ W266), H250 (≠ A267), G269 (= G286), A270 (≠ T287), R271 (= R288), D273 (≠ G290), R275 (≠ A292), V276 (≠ T293), E302 (≠ Y313), V303 (≠ P314), N307 (≠ E318), G320 (≠ A331), D321 (= D332), A322 (vs. gap), Q396 (≠ A402), M397 (≠ L403), G415 (vs. gap), G416 (≠ T421)
- binding magnesium ion: D445 (= D450), N472 (= N477), E474 (≠ I479)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E63), P80 (= P89), G418 (= G423), M420 (= M425), M450 (= M455)
Sites not aligning to the query:
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 94:646/687 of P07342
- R241 (= R165) binding
- 355:376 (vs. 267:288, 41% identical) binding
- 407:426 (vs. 313:332, 10% identical) binding
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 14:566/607 of 6u9dB
- active site: Y33 (≠ V36), G35 (= G38), G36 (≠ E39), A37 (≠ S40), I38 (≠ Y41), E59 (= E63), T82 (= T86), F121 (= F125), Q122 (= Q126), E123 (= E127), K171 (≠ E175), M274 (≠ W266), V301 (≠ T293), V417 (≠ A398), G443 (= G423), M445 (= M425), D470 (= D450), N497 (= N477), E499 (≠ I479), Q500 (≠ W480), M502 (≠ T482), V503 (≠ I483), W506 (≠ H486)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (≠ E39), V111 (= V115), P112 (≠ G116), F121 (= F125), K171 (≠ E175), D299 (≠ E291), R300 (≠ A292), M502 (≠ T482), W506 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R165), A228 (≠ G221), G229 (≠ S222), N232 (≠ T225), T254 (≠ A246), L255 (≠ W247), Q256 (≠ R248), L272 (≠ V264), M274 (≠ W266), G294 (= G286), R296 (= R288), D298 (≠ G290), R300 (≠ A292), V301 (≠ T293), E327 (≠ Y313), V328 (≠ P314), N332 (≠ E318), D346 (= D332), A347 (vs. gap), M422 (≠ L403), G440 (vs. gap), G441 (≠ T421)
- binding magnesium ion: D470 (= D450), N497 (= N477)
- binding thiamine diphosphate: E59 (= E63), P85 (= P89), V417 (≠ A398), G418 (= G399), Q419 (≠ N400), H420 (≠ Y401), G443 (= G423), M445 (= M425), A471 (≠ G451), S472 (≠ C452), N497 (= N477), E499 (≠ I479), Q500 (≠ W480), G501 (= G481), M502 (≠ T482), V503 (≠ I483)
5imsA Saccharomyces cerevisiae acetohydroxyacid synthase
28% identity, 93% coverage: 17:550/575 of query aligns to 12:540/541 of 5imsA
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), R229 (= R230), M265 (≠ W266), V292 (≠ T293), V408 (≠ A398), L433 (≠ V422), G434 (= G423), M436 (= M425), D461 (= D450), N488 (= N477), E490 (≠ I483), L502 (= L508), G507 (≠ R513), L508 (≠ G514)
- binding flavin-adenine dinucleotide: R159 (= R165), G218 (= G220), A219 (≠ G221), G220 (≠ S222), N223 (≠ T225), T245 (≠ A246), L246 (≠ W247), L263 (≠ V264), G264 (= G265), H266 (≠ A267), G285 (= G286), A286 (≠ T287), R287 (= R288), D289 (≠ G290), R291 (≠ A292), V292 (≠ T293), E318 (≠ Y313), V319 (≠ P314), N323 (≠ E318), D337 (= D332), A338 (vs. gap)
- binding magnesium ion: D461 (= D450), N488 (= N477)
- binding oxygen molecule: G34 (≠ E39), T80 (= T86), Q120 (= Q126)
- binding thiamine diphosphate: P32 (= P37), E57 (= E63), V408 (≠ A398), G409 (= G399), Q410 (≠ N400), H411 (≠ Y401), G434 (= G423), M436 (= M425), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ C452), M466 (= M455), N488 (= N477)
Sites not aligning to the query:
6bd3A Saccharomyces cerevisiae acetohydroxyacid synthase
28% identity, 93% coverage: 17:550/575 of query aligns to 12:536/538 of 6bd3A
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), R225 (= R230), M261 (≠ W266), V288 (≠ T293), V404 (≠ A398), L429 (≠ V422), G430 (= G423), M432 (= M425), D457 (= D450), N484 (= N477), L498 (= L508), G503 (≠ R513), L504 (≠ G514)
- binding flavin-adenine dinucleotide: R159 (= R165), G214 (= G220), A215 (≠ G221), G216 (≠ S222), N219 (≠ T225), T241 (≠ A246), L242 (≠ W247), Q243 (≠ R248), L259 (≠ V264), G260 (= G265), H262 (≠ A267), G281 (= G286), A282 (≠ T287), R283 (= R288), D285 (≠ G290), R287 (≠ A292), V288 (≠ T293), E314 (≠ Y313), V315 (≠ P314), D333 (= D332), A334 (vs. gap)
- binding 2-acetyl-thiamine diphosphate: P32 (= P37), E57 (= E63), P83 (= P89)
- binding magnesium ion: D457 (= D450), N484 (= N477)
- binding oxygen molecule: A35 (≠ S40), T80 (= T86), S81 (≠ R87), Q120 (= Q126)
- binding thiamine diphosphate: V404 (≠ A398), G405 (= G399), Q406 (≠ N400), H407 (≠ Y401), G430 (= G423), M432 (= M425), D457 (= D450), A458 (≠ G451), S459 (≠ C452), M462 (= M455), N484 (= N477)
Sites not aligning to the query:
1jscA Crystal structure of the catalytic subunit of yeast acetohydroxyacid synthase: a target for herbicidal inhibitors (see paper)
28% identity, 93% coverage: 17:550/575 of query aligns to 12:539/541 of 1jscA
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), M263 (≠ W266), V290 (≠ T293), V406 (≠ A398), G432 (= G423), M434 (= M425), D459 (= D450), N486 (= N477), E488 (≠ R484)
- binding dihydrogenphosphate ion: G33 (= G38), G34 (≠ E39), Q120 (= Q126)
- binding flavin-adenine dinucleotide: R159 (= R165), G216 (= G220), A217 (≠ G221), G218 (≠ S222), N221 (≠ T225), T243 (≠ A246), L244 (≠ W247), L261 (≠ V264), G262 (= G265), H264 (≠ A267), G283 (= G286), A284 (≠ T287), R285 (= R288), D287 (≠ G290), R289 (≠ A292), V290 (≠ T293), E316 (≠ Y313), V317 (≠ P314), N321 (≠ E318), G334 (≠ A331), D335 (= D332), A336 (vs. gap)
- binding magnesium ion: D459 (= D450), N486 (= N477)
- binding thiamine diphosphate: Y31 (≠ V36), P32 (= P37), E57 (= E63), P83 (= P89), V406 (≠ A398), G407 (= G399), Q408 (≠ N400), H409 (≠ Y401), M434 (= M425), D459 (= D450), A460 (≠ G451), S461 (≠ C452), N486 (= N477)
Sites not aligning to the query:
6bd9A Saccharomyces cerevisiae acetohydroxyacid synthase
28% identity, 93% coverage: 17:550/575 of query aligns to 12:540/542 of 6bd9A
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), R228 (= R230), M264 (≠ W266), V291 (≠ T293), V407 (≠ A398), L432 (≠ V422), G433 (= G423), M435 (= M425), D460 (= D450), N487 (= N477), E489 (≠ R484), L502 (= L508), G507 (≠ R513), L508 (≠ G514)
- binding flavin-adenine dinucleotide: R159 (= R165), G217 (= G220), A218 (≠ G221), G219 (≠ S222), N222 (≠ T225), T244 (≠ A246), L245 (≠ W247), L262 (≠ V264), G263 (= G265), H265 (≠ A267), G284 (= G286), A285 (≠ T287), R286 (= R288), D288 (≠ G290), R290 (≠ A292), V291 (≠ T293), E317 (≠ Y313), V318 (≠ P314), N322 (≠ E318), G335 (≠ A331), D336 (= D332), A337 (vs. gap)
- binding magnesium ion: D460 (= D450), N487 (= N477)
- binding oxygen molecule: G34 (≠ E39), T80 (= T86), Q120 (= Q126), A461 (≠ G451), Q494 (≠ R489)
- binding pyruvic acid: G33 (= G38), G34 (≠ E39), G34 (≠ E39), A35 (≠ S40), Q120 (= Q126)
- binding thiamine diphosphate: P32 (= P37), E57 (= E63), V407 (≠ A398), G408 (= G399), Q409 (≠ N400), H410 (≠ Y401), G433 (= G423), M435 (= M425), G459 (= G449), D460 (= D450), A461 (≠ G451), S462 (≠ C452), M465 (= M455), N487 (= N477)
Sites not aligning to the query:
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
28% identity, 87% coverage: 17:516/575 of query aligns to 12:522/593 of 6deoA
- active site: Y31 (≠ V36), G33 (= G38), G34 (≠ E39), A35 (≠ S40), I36 (≠ Y41), E57 (= E63), T80 (= T86), F119 (= F125), Q120 (= Q126), E121 (= E127), K169 (≠ E175), K224 (≠ R230), M260 (≠ W266), V287 (≠ T293), V403 (≠ A398), L428 (≠ V422), G429 (= G423), M431 (= M425), D456 (= D450), N483 (= N477), E485 (≠ I479), Q486 (≠ W480), M488 (≠ T482), V489 (≠ I483), W492 (≠ H486), L514 (= L508), N519 (≠ R513), V520 (≠ G514)
- binding flavin-adenine dinucleotide: R159 (= R165), G213 (= G220), A214 (vs. gap), G215 (= G221), N218 (≠ W224), T240 (≠ A246), L241 (≠ W247), Q242 (≠ R248), L258 (≠ V264), G280 (= G286), A281 (≠ T287), R282 (= R288), D284 (≠ G290), R286 (≠ A292), V287 (≠ T293), E313 (≠ Y313), I314 (≠ P314), N318 (≠ E318), D332 (= D332), V333 (= V333), M408 (≠ L403), G426 (vs. gap)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ W266), D285 (≠ E291), R286 (≠ A292), M488 (≠ T482), W492 (≠ H486)
- binding magnesium ion: D456 (= D450), N483 (= N477), E485 (≠ I479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ A398), G404 (= G399), Q405 (≠ N400), H406 (≠ Y401), G429 (= G423), M431 (= M425), G455 (= G449), D456 (= D450), A457 (≠ G451), S458 (≠ C452), M461 (= M455), N483 (= N477), E485 (≠ I479), Q486 (≠ W480), G487 (= G481), M488 (≠ T482), V489 (≠ I483)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
28% identity, 87% coverage: 17:516/575 of query aligns to 16:530/601 of 6deqA
- active site: Y35 (≠ V36), G37 (= G38), G38 (≠ E39), A39 (≠ S40), I40 (≠ Y41), E61 (= E63), T84 (= T86), F123 (= F125), Q124 (= Q126), E125 (= E127), K173 (≠ E175), K232 (≠ R230), M268 (≠ W266), V295 (≠ T293), V411 (≠ A398), L436 (≠ V422), G437 (= G423), M439 (= M425), D464 (= D450), N491 (= N477), E493 (≠ I479), Q494 (≠ W480), M496 (≠ T482), V497 (≠ I483), W500 (≠ H486), L522 (= L508), N527 (≠ R513), V528 (≠ G514)
- binding flavin-adenine dinucleotide: R163 (= R165), G221 (= G220), A222 (vs. gap), G223 (= G221), N226 (≠ W224), T248 (≠ A246), L249 (≠ W247), Q250 (≠ R248), L266 (≠ V264), G288 (= G286), A289 (≠ T287), R290 (= R288), D292 (≠ G290), R294 (≠ A292), V295 (≠ T293), E321 (≠ Y313), I322 (≠ P314), D340 (= D332), V341 (= V333), M416 (≠ L403), G434 (vs. gap)
- binding magnesium ion: D464 (= D450), N491 (= N477), E493 (≠ I479)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ W266), R294 (≠ A292), M496 (≠ T482), V497 (≠ I483), W500 (≠ H486)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (≠ A398), G412 (= G399), Q413 (≠ N400), H414 (≠ Y401), M439 (= M425), G463 (= G449), D464 (= D450), A465 (≠ G451), S466 (≠ C452), N491 (= N477), E493 (≠ I479), Q494 (≠ W480), G495 (= G481), M496 (≠ T482), V497 (≠ I483)
Sites not aligning to the query:
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
28% identity, 87% coverage: 17:516/575 of query aligns to 14:527/598 of 6desA
- active site: Y33 (≠ V36), G35 (= G38), G36 (≠ E39), A37 (≠ S40), I38 (≠ Y41), E59 (= E63), T82 (= T86), F121 (= F125), Q122 (= Q126), E123 (= E127), K171 (≠ E175), K229 (≠ R230), M265 (≠ W266), V292 (≠ T293), V408 (≠ A398), L433 (≠ V422), G434 (= G423), M436 (= M425), D461 (= D450), N488 (= N477), E490 (≠ I479), Q491 (≠ W480), M493 (≠ T482), V494 (≠ I483), W497 (≠ H486), L519 (= L508), N524 (≠ R513), V525 (≠ G514)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ W266), D290 (≠ E291), R291 (≠ A292), W497 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R165), G218 (= G220), A219 (vs. gap), G220 (= G221), N223 (≠ W224), T245 (≠ A246), L246 (≠ W247), Q247 (≠ R248), L263 (≠ V264), G285 (= G286), A286 (≠ T287), R287 (= R288), D289 (≠ G290), R291 (≠ A292), V292 (≠ T293), E318 (≠ Y313), I319 (≠ P314), N323 (≠ E318), D337 (= D332), V338 (= V333), Q412 (≠ A402), M413 (≠ L403), G431 (vs. gap)
- binding magnesium ion: D461 (= D450), N488 (= N477), E490 (≠ I479)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A398), G409 (= G399), Q410 (≠ N400), H411 (≠ Y401), G434 (= G423), M436 (= M425), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ C452), N488 (= N477), E490 (≠ I479), Q491 (≠ W480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
28% identity, 87% coverage: 17:516/575 of query aligns to 14:527/598 of 6depA
- active site: Y33 (≠ V36), G35 (= G38), G36 (≠ E39), A37 (≠ S40), I38 (≠ Y41), E59 (= E63), T82 (= T86), F121 (= F125), Q122 (= Q126), E123 (= E127), K171 (≠ E175), K229 (≠ R230), M265 (≠ W266), V292 (≠ T293), V408 (≠ A398), L433 (≠ V422), G434 (= G423), M436 (= M425), D461 (= D450), N488 (= N477), E490 (≠ I479), Q491 (≠ W480), M493 (≠ T482), V494 (≠ I483), W497 (≠ H486), L519 (= L508), N524 (≠ R513), V525 (≠ G514)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ E291), R291 (≠ A292), M493 (≠ T482), W497 (≠ H486)
- binding flavin-adenine dinucleotide: R161 (= R165), G218 (= G220), A219 (vs. gap), G220 (= G221), N223 (≠ W224), T245 (≠ A246), L246 (≠ W247), Q247 (≠ R248), L263 (≠ V264), G264 (= G265), G285 (= G286), A286 (≠ T287), R287 (= R288), D289 (≠ G290), R291 (≠ A292), V292 (≠ T293), E318 (≠ Y313), I319 (≠ P314), N323 (≠ E318), D337 (= D332), V338 (= V333), M413 (≠ L403), G431 (vs. gap)
- binding magnesium ion: D461 (= D450), N488 (= N477), E490 (≠ I479)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ A398), G409 (= G399), Q410 (≠ N400), H411 (≠ Y401), G434 (= G423), M436 (= M425), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ C452), M466 (= M455), N488 (= N477), E490 (≠ I479), Q491 (≠ W480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A398), G409 (= G399), Q410 (≠ N400), H411 (≠ Y401), G434 (= G423), M436 (= M425), G460 (= G449), D461 (= D450), A462 (≠ G451), S463 (≠ C452), M466 (= M455), N488 (= N477), E490 (≠ I479), Q491 (≠ W480), G492 (= G481), M493 (≠ T482), V494 (≠ I483)
Query Sequence
>RR42_RS26245 FitnessBrowser__Cup4G11:RR42_RS26245
MNKQSPQALPARTARNGGQILIDQLIIQGVKRVFLVPGESYLPCIDALYDHQDKIQPIVC
RQESGAGYMAEAQGKLTGEPGICFVTRGPGATNASIAVHTAYQDSTPMILFVGQVGNDFY
EREAFQEVDYRRMFGQMTKWVAQIDRTERIPEFIARAFAVATSGRPGPVVLALPEDTLWG
KATVADVPRYRRAHSAPTPDAVASLAELIEQAERPFLLLGGSGWTPAASRQMEGFAERFA
LPVGVAWRRLECFDNHHPNFAGHVGWAMPESLRKRVQESDLLIAVGTRMGEATSEGYTVV
ESPLPRQRLVHVYPDANELGRVFHPTLPIAADVVSFAAAVAELSPSRSPGARNAGHDAHQ
VYLAEQEPKAAPGALNLNVAACHVRDNVPQDTCITVGAGNYALYPHAYYRFKGVGTSLAP
TVGSMGYGLPAAIAAKLENPDRTVICYAGDGCFQMNLQELGVAMQYRVGIVVLVFNNGIW
GTIRAHQEREFPGRTVALGFDNPEFSELIRAYRGYGEIVASDEAFGPAFARALAFANTQQ
LPALLELRYDADGIAPGMTLSQIRSDALARQAGAK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory